Recombinant GILT-like protein C02D5.2 (C02D5.2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
C02D5.2; GILT-like protein C02D5.2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-323
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
C02D5.2
Target Protein Sequence
MSKYLRTSHPSPLICRPILTFSSLHILTAFLISGNSSYINWSVTIILLILGLYACHRFLN MKKLTRDAQEPLLPHIRPSTRNKIRKYIYGTIFILSIFLLYRSLNSPDTSKHGIGRNGDF IEYEPKAGPTIKEPVENIVKLDVYMEAQCPDTSRFFRQQLKKAWDILGRLNRIELNVIPF GKARCTEKGNDFECQCQHGPTECQINQLMNCVIDRFGFPHRYLPGVLCMQGKYSLDEAMK CVTENYPSEYERMRECASGTRGRRLLALSGQKTASLTPAIDFIPWIVINGSRNSDALYDL TQNVCEAMQPMPSACKDYLRSLQ
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_C02D5.2

UniGene: Cel.10913

Protein Families
GILT family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is GILT-like protein C02D5.2 and what is its relevance in immunological research?

GILT-like protein C02D5.2 is a protein found in Caenorhabditis elegans that shares structural and functional similarities with gamma-interferon-inducible lysosomal thiol reductase (GILT). The protein is categorized as a thiol reductase enzyme that potentially plays a role in the processing of disulfide-bonded proteins in the endocytic pathway. Its study is relevant to immunological research because the human GILT homolog is a critical component of the MHC class II antigen presentation pathway, facilitating the reduction of disulfide bonds in protein antigens within the endosomal/lysosomal compartments .

GILT's reductase activity is particularly important for exposing buried epitopes within disulfide-containing proteins, thereby enhancing MHC class II-restricted presentation . By studying the C. elegans GILT-like protein C02D5.2, researchers can gain insights into the evolutionary conservation of this important immunological mechanism and potentially identify novel functions applicable to human health and disease.

What are the optimal expression systems and purification methods for producing recombinant GILT-like protein C02D5.2?

When producing recombinant GILT-like protein C02D5.2, researchers have several expression system options, each with distinct advantages:

Expression Systems:

  • E. coli: Offers high yield and cost-effectiveness, though may face challenges with proper folding of disulfide-rich proteins.

  • Yeast: Provides eukaryotic post-translational modifications with moderate yield.

  • Baculovirus: Maintains high fidelity for insect-derived proteins with good yield.

  • Mammalian Cell: Delivers the most authentic post-translational modifications, particularly important if studying the protein's interaction with mammalian systems .

Purification Protocol:

  • Initial Processing: After expression, centrifuge to isolate the protein from cellular components.

  • Tag-Based Purification: Utilize affinity chromatography based on the specific tag incorporated into the recombinant protein.

  • Quality Control: Verify purity using SDS-PAGE, with an expected purity of ≥85% .

  • Storage Considerations: Store in Tris-based buffer with 50% glycerol at -20°C for regular use or -80°C for extended storage. Aliquot the protein to avoid repeated freeze-thaw cycles, and working aliquots can be stored at 4°C for up to one week .

The selection of expression system should be guided by the specific experimental requirements, particularly considering whether native conformation and post-translational modifications are essential for the study objectives.

How should researchers design experiments to study GILT-like protein C02D5.2 function in relation to protein processing and immune responses?

Designing rigorous experiments to study GILT-like protein C02D5.2 requires careful consideration of several key experimental design principles:

Experimental Design Framework:

  • Define Clear Variables:

    • Independent variable: The specific manipulation of GILT-like protein C02D5.2 (e.g., expression levels, mutations, or absence).

    • Dependent variable: Measurable outcomes such as protein processing efficiency, immune response parameters, or protein-protein interactions.

    • Control variables: Factors that must be standardized across experimental conditions .

  • Control Group Implementation:

    • Establish appropriate control groups that differ only in the GILT-like protein C02D5.2 variable.

    • Include both positive controls (known to exhibit the effect) and negative controls (known not to exhibit the effect) .

  • Reductase Activity Assays:

    • Design enzymatic assays to measure the protein's ability to reduce disulfide bonds using model substrates.

    • Implement pH controls to simulate the acidic environment of lysosomes/endosomes where the protein naturally functions.

  • Interaction Studies:

    • Utilize co-immunoprecipitation or yeast two-hybrid assays to identify protein-protein interactions.

    • Consider proximity labeling approaches for in vivo interaction studies.

  • Functional Assessment:

    • In C. elegans, implement RNAi knockdown or CRISPR/Cas9 knockout of the C02D5.2 gene to assess phenotypic changes.

    • Measure impacts on protein processing pathways, particularly those involving disulfide-rich proteins.

  • Translational Applications:

    • Design comparative studies between C. elegans GILT-like protein C02D5.2 and human GILT to identify conserved functional domains and mechanisms.

When reporting results, researchers should clearly document all parameters of the experimental design, including sample sizes, randomization methods, and statistical analyses employed to ensure reproducibility and validity of findings .

How does GILT-like protein C02D5.2 compare functionally with human GILT in antigen presentation pathways?

While GILT-like protein C02D5.2 from C. elegans and human GILT share structural similarities, their functional roles in antigen presentation pathways have important differences and similarities:

Comparative Analysis:

FeatureHuman GILTC. elegans GILT-like protein C02D5.2
Expression RegulationConstitutively expressed in APCs; IFN-γ inducible in other cells Expression patterns less well characterized; likely constitutively expressed in certain tissues
Subcellular LocalizationEndosomal/lysosomal compartments Predicted to be similar but requires experimental verification
Enzymatic FunctionReduction of protein disulfide bonds Presumed similar thiol reductase activity based on sequence homology
Role in Antigen PresentationFacilitates MHC class II-restricted presentation by exposing buried epitopes within disulfide-bonded proteins C. elegans lacks adaptive immunity and MHC molecules, suggesting alternative functions
Clinical RelevanceAssociated with improved survival in melanoma patients treated with immune checkpoint inhibitors No direct clinical applications, but valuable for evolutionary studies of immune mechanisms

The fundamental difference lies in the absence of adaptive immunity in C. elegans, which lacks T cells and the MHC class II presentation pathway found in vertebrates. This suggests that GILT-like protein C02D5.2 may have either evolved different functions in C. elegans or represents an ancestral protein that was later co-opted for immune functions in vertebrates. Understanding these evolutionary adaptations provides valuable insights into the fundamental mechanisms of protein processing across species .

What methodological approaches can address the challenges in studying protein-protein interactions involving GILT-like protein C02D5.2?

Investigating protein-protein interactions involving GILT-like protein C02D5.2 presents several challenges that require sophisticated methodological approaches:

Challenge-Specific Methodologies:

  • Membrane Association Challenges:

    • Approach: Utilize membrane-compatible interaction detection methods such as split-ubiquitin systems or bimolecular fluorescence complementation (BiFC).

    • Rationale: As GILT-like proteins often function in membrane-bound compartments, traditional yeast two-hybrid systems may yield false negatives .

  • Transient Interaction Detection:

    • Approach: Implement crosslinking mass spectrometry (XL-MS) or proximity labeling techniques (BioID, APEX).

    • Rationale: Enzyme-substrate interactions are often transient and difficult to capture with conventional methods.

  • Compartment-Specific Interactions:

    • Approach: Use subcellular fractionation combined with co-immunoprecipitation or proximity labeling specifically targeting endosomal/lysosomal compartments.

    • Rationale: Ensures detection of interactions that occur only in the native subcellular environment of the protein.

  • Validation Strategy:

    • Primary Screening: Use high-throughput approaches like protein microarrays with recombinant GILT-like protein C02D5.2.

    • Secondary Validation: Confirm interactions using multiple orthogonal methods (e.g., ELISA, Surface Plasmon Resonance).

    • Tertiary Functional Validation: Assess the biological significance of identified interactions through functional assays in C. elegans .

  • Bioinformatic Integration:

    • Approach: Employ computational predictions based on orthology with known GILT interactors from other species.

    • Rationale: HCOP (HGNC Comparison of Orthology Predictions) and similar tools can identify potential interactors based on evolutionary conservation .

When designing such studies, researchers should carefully consider appropriate controls for each method, including both positive controls (known interactors of thiol reductases) and negative controls (proteins unlikely to interact with endosomal/lysosomal proteins).

How can differential gene expression data inform research on GILT-like protein C02D5.2 function in different biological contexts?

Differential gene expression analysis provides powerful insights into the function of GILT-like protein C02D5.2 in various biological contexts:

Methodological Framework for Expression Analysis:

  • Transcriptomic Approach Selection:

    • Bulk RNA-Seq: Appropriate for tissue-level expression patterns

    • Single-Cell RNA-Seq: Valuable for identifying cell-specific expression patterns

    • Temporal RNA-Seq: Essential for developmental studies in C. elegans

  • Expression Pattern Analysis:

    • Examine co-expression networks to identify genes with similar expression patterns to C02D5.2

    • Implement fold-change analysis similar to approaches used in biotrophic phase studies , focusing on log2 fold-changes to quantify expression differences

  • Contextual Expression Studies:

    • Stress Conditions: Monitor expression changes under immune challenges

    • Developmental Stages: Track expression throughout C. elegans life cycle

    • Tissue-Specific Patterns: Identify primary sites of expression

  • Comparative Genomics Application:

    • Analyze expression patterns of GILT-like protein C02D5.2 in comparison to orthologs in other species

    • Create expression profile maps across evolutionary related proteins

  • Functional Correlation:

    • Correlate expression patterns with specific phenotypes or biological processes

    • Utilize gene ontology enrichment analysis to identify biological processes associated with GILT-like protein expression

For example, in melanoma research, differential expression analysis revealed that high GILT expression is associated with improved survival in metastatic melanoma patients treated with immune checkpoint inhibitors . Similar approaches could identify conditions where C02D5.2 expression changes significantly in C. elegans, providing clues to its functional roles.

What are common technical challenges in purifying active recombinant GILT-like protein C02D5.2 and how can they be addressed?

Researchers frequently encounter several technical challenges when purifying functional recombinant GILT-like protein C02D5.2:

Challenge 1: Protein Aggregation and Insolubility

  • Problem: GILT-like proteins contain multiple disulfide bonds that may form incorrectly during expression, leading to aggregation.

  • Solution:

    • Express the protein in oxidizing environments (periplasmic space in E. coli or eukaryotic systems)

    • Include folding enhancers such as low concentrations of urea (0.5-1 M) or mild detergents during purification

    • Optimize buffer conditions, particularly pH and salt concentrations, based on the protein's isoelectric point

Challenge 2: Degradation During Purification

  • Problem: Proteolytic degradation during extraction and purification.

  • Solution:

    • Add protease inhibitor cocktails immediately after cell lysis

    • Maintain samples at 4°C throughout the purification process

    • Minimize processing time and reduce the number of purification steps

Challenge 3: Loss of Enzymatic Activity

  • Problem: Loss of reductase activity during purification or storage.

  • Solution:

    • Include reducing agents like DTT or β-mercaptoethanol during purification (but remove before activity assays if measuring reductase function)

    • Store with 50% glycerol to maintain protein stability

    • Avoid repeated freeze-thaw cycles by creating single-use aliquots

Challenge 4: Contamination with Co-Purifying Proteins

  • Problem: Non-specific binding of contaminant proteins during affinity purification.

  • Solution:

    • Implement two-step purification strategies combining affinity chromatography with size exclusion or ion exchange chromatography

    • Optimize washing conditions by testing various salt concentrations and detergents

    • Verify purity using SDS-PAGE, aiming for ≥85% purity as specified in commercial preparations

When troubleshooting purification issues, systematically alter one variable at a time and document results thoroughly to identify optimal conditions for your specific experimental setup.

How should researchers integrate findings from GILT-like protein C02D5.2 studies in C. elegans with knowledge of human GILT in translational research?

Integrating findings from C. elegans GILT-like protein C02D5.2 studies with human GILT research requires careful consideration of both the similarities and differences between these systems:

Translational Research Framework:

  • Structural Homology Assessment:

    • Conduct detailed sequence alignments and structural modeling to identify conserved domains and catalytic sites

    • Focus particularly on the thioredoxin-like motifs and active site residues that are likely conserved across species

    • Use this information to predict which functional aspects are likely preserved between species

  • Functional Conservation Verification:

    • Test whether C. elegans GILT-like protein C02D5.2 can complement deficiencies in human GILT in cellular models

    • Determine if key enzymatic properties, such as optimal pH, substrate specificity, and reaction kinetics, are comparable

  • Development of C. elegans as a Model System:

    • Create transgenic C. elegans expressing human GILT to study its function in a simplified in vivo system

    • Utilize the genetic tractability of C. elegans to perform high-throughput screens for modifiers of GILT function

  • Pathway Analysis Integration:

    • Map protein interaction networks in both systems to identify conserved pathways

    • Focus on fundamental cellular processes that evolved before the divergence of these species

  • Translational Applications Development:

    • Use insights from C. elegans studies to inform the development of modulators of human GILT activity

    • Consider how findings related to C. elegans GILT-like protein C02D5.2 regulation might apply to controlling human GILT expression in disease contexts

This integrative approach recognizes that while direct translation of findings may be limited by evolutionary divergence, mechanistic insights regarding protein folding, enzymatic function, and basic cellular roles can provide valuable direction for human studies. Importantly, researchers should clearly acknowledge the limitations of cross-species extrapolation when reporting findings .

What emerging technologies and approaches could enhance our understanding of GILT-like protein C02D5.2 functions?

Several cutting-edge technologies and methodological approaches hold promise for advancing our understanding of GILT-like protein C02D5.2:

Emerging Research Approaches:

  • CRISPR-Based Technologies:

    • Gene Editing: Generate precise mutations in functional domains to analyze structure-function relationships

    • CRISPRi/CRISPRa: Implement inducible systems to modulate C02D5.2 expression without permanent genetic changes

    • Base Editing: Introduce specific amino acid substitutions to assess their impact on protein function

  • Advanced Imaging Techniques:

    • Super-Resolution Microscopy: Visualize subcellular localization with nanometer precision

    • Live-Cell Imaging: Track protein dynamics in real-time using fluorescent tags

    • Correlative Light and Electron Microscopy (CLEM): Combine functional imaging with ultrastructural analysis

  • Protein Structure Analysis:

    • Cryo-EM: Determine high-resolution structures without crystallization

    • AlphaFold2/RoseTTAFold: Apply AI-based prediction methods to model protein structure and interactions

    • Hydrogen-Deuterium Exchange Mass Spectrometry: Map protein dynamics and conformational changes

  • Systems Biology Integration:

    • Multi-Omics Approaches: Combine proteomics, transcriptomics, and metabolomics data

    • Network Analysis: Identify functional modules and pathway connections

    • Mathematical Modeling: Develop quantitative models of GILT-like protein activity within cellular pathways

  • Single-Molecule Techniques:

    • Single-Molecule FRET: Measure conformational changes during catalysis

    • Optical Tweezers: Assess protein-substrate interactions at the single-molecule level

    • Nanopore Analysis: Study protein folding and interaction dynamics

These advanced technologies can help address persistent knowledge gaps regarding GILT-like protein C02D5.2 function, particularly when integrated into well-designed experimental frameworks that build upon existing knowledge of thiol reductases and their roles in protein processing pathways.

What are the potential implications of GILT-like protein research for understanding immune-related diseases and developing novel therapeutic approaches?

Research on GILT-like proteins, including C02D5.2, has significant implications for understanding and treating immune-related diseases:

Translational Research Implications:

  • Cancer Immunotherapy Enhancement:

    • Human GILT expression is associated with improved survival in melanoma patients treated with immune checkpoint inhibitors, suggesting it may serve as a biomarker for treatment response

    • Understanding the mechanisms by which GILT enhances antigen presentation could lead to strategies to improve cancer immunotherapy efficacy

    • Potential development of GILT-modulating compounds that could enhance tumor antigen presentation

  • Autoimmune Disease Insights:

    • Dysregulation of antigen processing and presentation is implicated in many autoimmune diseases

    • GILT's role in processing specific antigens may explain why certain disulfide-rich proteins become autoantigens

    • Modulating GILT activity could potentially reduce presentation of specific autoantigens while preserving general immune function

  • Vaccine Development Applications:

    • Knowledge of GILT's role in antigen processing could inform the design of more effective vaccine antigens

    • Engineering antigens to be optimally processed by GILT could enhance immunogenicity

    • Development of adjuvants that modulate GILT expression or activity to enhance vaccine responses

  • Neurodegenerative Disease Connections:

    • Protein misfolding and aggregation are hallmarks of many neurodegenerative diseases

    • GILT-like proteins may influence the processing of disulfide-containing proteins involved in these conditions

    • The thiol reductase activity of GILT-like proteins might be harnessed to reduce pathological protein aggregation

  • Infectious Disease Approaches:

    • GILT's role in processing microbial antigens makes it relevant for host-pathogen interactions

    • Some pathogens may evade immunity by interfering with GILT function

    • Therapeutic strategies aimed at enhancing GILT activity could potentially boost antimicrobial immunity

While much of this translational potential derives from research on human GILT, studies of evolutionary conserved proteins like C. elegans GILT-like protein C02D5.2 provide fundamental insights into the core mechanisms and functions that can guide therapeutic development. The evolutionary distance between C. elegans and humans also offers unique opportunities to identify essential, conserved functions that may represent particularly robust therapeutic targets .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.