Recombinant Ginkgo biloba Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

The cemA protein in Ginkgo biloba is a chloroplast envelope membrane-localized potassium/proton antiporter. It facilitates proton efflux to regulate pH and ion balance in chloroplasts, essential for photosynthesis and stress responses . The recombinant form is produced via heterologous expression systems (e.g., E. coli) for biochemical and functional studies .

Protein Characteristics

  • Sequence: Full-length cemA consists of 392 amino acids (predicted molecular weight ~43 kDa) .

  • Domains: Contains conserved motifs for K+/H+ antiport activity, with transmembrane helices characteristic of membrane transport proteins .

  • Post-Translational Modifications: Typically expressed with an N-terminal His-tag for purification .

Functional Data

PropertyValue/DescriptionSource
ActivityK+/H+ antiport, pH regulation
Expression SystemE. coli (soluble form)
Purity>90% (SDS-PAGE verified)
StorageLyophilized, stable at -80°C

Production and Purification

Recombinant cemA is synthesized using plasmid vectors (e.g., pMAL-C2X) in E. coli strains like Novablue . Key steps include:

  1. Cloning: Full-length cemA cDNA is amplified and ligated into expression vectors .

  2. Expression: Induced with IPTG, followed by affinity chromatography (e.g., Ni-NTA for His-tagged proteins) .

  3. Purification: Sepharose CL-6B or similar matrices isolate functional protein .

Research Applications

  • Ion Transport Studies: Used to dissect chloroplast membrane dynamics and proton gradient maintenance .

  • Stress Response Modeling: Investigated in contexts like light-dependent pH fluctuations and abiotic stress .

  • Comparative Genomics: Phylogenetic analyses reveal conservation across gymnosperms and angiosperms .

Challenges and Future Directions

  • Functional Complexity: Multifunctional roles in chloroplast homeostasis require advanced structural studies (e.g., cryo-EM) .

  • Biotechnological Potential: Engineered variants could optimize ion transport in synthetic biology applications .

This synthesis underscores recombinant cemA’s utility in plant physiology research, with commercial and academic relevance. Future work may leverage omics data (e.g., co-expression networks ) to explore its regulatory networks.

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-261
Protein Length
full length protein
Species
Ginkgo biloba (Ginkgo) (Maidenhair tree)
Target Names
cemA
Target Protein Sequence
MGPIPRSITRTLSRFRTELTSESSPLVIHELKVAKYKVSASLQYLAFLVFLPWGISISFQ EGLGPWVTNWWNTGQSKIFFSYLQEENALERFGEIEELFLLERMVEDSSETHSQDLRIEI HRKTIQLVKMYNKDCIQIISHLLTNMICFAISSAYFIMSKKKLTVLNSWIQELFYSLSDT MKAFSIISVTDLCIGFHSTHGWELMIDSISENYGFVHNEQIISGLVPTFPVISDTIFKYW IFRHFNRISPPLVVIYHSMNE
Uniprot No.

Target Background

Function

This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.

Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

Where is the cemA gene located in the Ginkgo biloba chloroplast genome and how has it evolved?

The cemA gene is located in the Ginkgo biloba chloroplast genome, which is a circular DNA molecule of approximately 156,945-156,990 bp . The G. biloba chloroplast genome has a quadripartite structure consisting of:

  • Large single-copy region (LSC): 99,259 bp

  • Small single-copy region (SSC): 22,267 bp

  • A pair of inverted repeat regions (IRa and IRb): each approximately 17,732 bp

The cemA gene is likely part of the conserved gene set within the protein-coding sequences of the chloroplast. The G. biloba chloroplast genome contains 85 protein-coding genes, 41 tRNA genes, and 8 rRNA genes .

Evolutionary analysis shows that Ginkgo has a unique chloroplast genome structure with shortened inverted repeats due to the loss of one ycf2 copy from the IR region. Unlike some gymnosperms that have lost entire IR regions, Ginkgo has maintained both IRs but with structural modifications . Phylogenetic studies place Ginkgo closer to cycads than to gnetophytes, Pinaceae, and cupressophytes .

What are the recommended methods for isolating and studying recombinant cemA protein?

Isolation and Purification:

For isolation of native chloroplast envelope proteins, researchers typically use:

  • Isolation of intact chloroplasts: Leaves (approximately 200g) are homogenized and processed through differential centrifugation.

  • Purification of envelope membranes: Using sucrose gradient ultracentrifugation to separate envelope membranes, which appear as a yellowish band without visible chlorophyll contamination.

  • Membrane protein extraction: Washing with sodium carbonate (1M) to remove weakly attached soluble proteins .

For recombinant cemA expression:

  • Heterologous expression systems: E. coli or yeast systems with appropriate tags for purification.

  • Solubilization considerations: Use of specific detergents for membrane protein extraction.

  • Purification using tag affinity: Typically involves a tag whose type "will be determined during production process" .

Storage conditions for recombinant cemA:

  • Store at -20°C

  • For extended storage, conserve at -20°C or -80°C

  • Avoid repeated freezing and thawing

  • For short-term use, store working aliquots at 4°C for up to one week

How can researchers investigate the functionality of recombinant cemA protein?

For functional characterization of recombinant cemA, researchers should consider these methodological approaches:

  • Proteoliposome Reconstitution Studies:

    • Incorporate purified cemA into artificial liposomes

    • Measure substrate transport activities

    • Assess membrane potential changes

  • Comparative Proteomics Analysis:

    • Use spatial proteomics to compare distribution across chloroplast subfractions

    • Calculate enrichment factors in envelope preparations versus total chloroplast lysate

    • MS-based protein identification in both total chloroplast and enriched envelope fractions

  • Genetic Complementation:

    • Express recombinant cemA in mutant plants lacking functional cemA

    • Evaluate phenotypic rescue and functional recovery

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation assays

    • Yeast two-hybrid or split-ubiquitin systems for membrane proteins

    • Blue native gel electrophoresis to identify protein complexes

  • Localization Confirmation:

    • Fusion with reporter proteins like GFP

    • Immunogold labeling for electron microscopy

How can researchers analyze cemA gene structure and evolution in Ginkgo biloba compared to other species?

Recommended comparative genomic approaches:

  • Sequence Alignment and Phylogenetic Analysis:

    • Multiple sequence alignment of cemA from diverse plant species

    • Construct phylogenetic trees using maximum likelihood or Bayesian inference

    • Identify conserved domains and species-specific variations

  • Synonymous (Ks) and Nonsynonymous (Ka) Substitution Analysis:

    • Calculate Ka/Ks ratios to assess selective pressure on cemA

    • Note that in ginkgo, gene loss events (like ycf2) don't necessarily lead to elevated Ks in retained genes

    • Compare substitution rates with other plant lineages like Cyperaceae which show accelerated rates

  • Structural Feature Identification:

    • Analyze for presence of introns, promoters, and regulatory elements

    • Examine codon usage bias - the AT content in G. biloba chloroplast coding regions is 52.97%, 60.52%, and 69.62% for first, second, and third codon positions respectively

  • IR Boundary Analysis:

    • Examine IR/SC boundaries to understand structural evolution

    • Map cemA location relative to these dynamic regions

    • Compare with other gymnosperms that show significant IR variation

What post-translational modifications occur in cemA and how do they affect protein function?

While specific information on cemA post-translational modifications is limited in the search results, research on chloroplast proteins generally suggests several important modifications:

  • Phosphorylation sites:

    • Likely occurs on serine, threonine, or tyrosine residues

    • May regulate transport activity or protein-protein interactions

    • Can be identified through mass spectrometry with phospho-enrichment techniques

  • Potential membrane topology:

    • As an envelope membrane protein, cemA likely has transmembrane domains

    • Prediction algorithms suggest multiple membrane-spanning regions

    • Experimental verification requires techniques like protease protection assays

  • Protein maturation:

    • Transit peptide cleavage during chloroplast import

    • Processing and folding within the chloroplast envelope

  • Research methodologies:

    • Mass spectrometry-based proteomics for PTM identification

    • Site-directed mutagenesis of key residues to assess functional impact

    • Structural analysis through techniques suitable for membrane proteins

What are the major technical challenges in studying recombinant cemA and how can they be overcome?

Major challenges and solutions:

  • Membrane Protein Expression and Purification:

    • Challenge: Low expression yields and protein misfolding

    • Solution: Optimize expression conditions using specialized E. coli strains, test multiple fusion tags, and employ mild detergents for extraction

  • Functional Reconstitution:

    • Challenge: Maintaining native conformation and activity

    • Solution: Screen multiple lipid compositions for proteoliposomes, optimize protein-to-lipid ratios, and validate functionality with specific assays

  • Structural Analysis:

    • Challenge: Obtaining high-resolution structures of membrane proteins

    • Solution: Consider alternative approaches like cryo-EM, solid-state NMR, or computational modeling

  • Protein Stability:

    • Challenge: cemA may be unstable when removed from its native environment

    • Solution: Store in optimized buffer (Tris-based buffer with 50% glycerol) , avoid repeated freeze-thaw cycles

  • Functional Redundancy:

    • Challenge: Determining specific function when potential redundancy exists

    • Solution: Combine biochemical approaches with genetic studies in model systems

How can research on recombinant cemA contribute to advances in plant biotechnology?

Research on recombinant cemA has several potential biotechnological applications:

  • Chloroplast Genetic Engineering:

    • Understanding cemA function may facilitate better design of chloroplast transformation vectors

    • Knowledge of envelope proteins is crucial for optimizing protein expression and targeting in transplastomic plants

  • Stress Tolerance Engineering:

    • If cemA functions in protection against environmental stresses, it could be utilized in developing stress-resistant crops

    • Potential applications similar to how Ginkgo biloba extract components (like diterpene ginkgolides) provide protective effects

  • Metabolic Engineering:

    • As an envelope membrane protein, cemA may influence metabolite transport

    • Engineering cemA could potentially enhance metabolic flux for production of valuable compounds

  • Photosynthetic Efficiency:

    • If cemA plays a role in photosynthetic processes, its modification could potentially improve carbon fixation or energy conversion

  • Evolutionary Research Platform:

    • The unique features of Ginkgo biloba chloroplast genome make it valuable for understanding plastid genome evolution

    • Studies of cemA contribute to broader understanding of chloroplast evolution

How is cemA gene expression regulated in Ginkgo biloba, and what methods can be used to study its regulation?

While specific information on cemA regulation is limited in the provided references, based on knowledge of chloroplast gene regulation and the available information about Ginkgo biloba, researchers can investigate cemA expression using:

  • Transcriptional Analysis:

    • RT-qPCR to quantify cemA transcript levels in different tissues and under various conditions

    • RNA-Seq to identify co-expressed genes and regulatory networks

    • Promoter analysis to identify potential regulatory elements

  • Post-transcriptional Regulation:

    • RNA editing analysis - Ginkgo biloba chloroplast genome is known to have at least five editing sites

    • Investigation of RNA processing and stability

    • Analysis of translation efficiency

  • Environmental Response:

    • Study cemA expression under various stresses (light, temperature, drought)

    • Compare with expression patterns of other chloroplast envelope proteins

  • Tissue-Specific Expression:

    • Similar to other Ginkgo genes like GbPAL (involved in flavonoid metabolism), cemA may show tissue-specific expression patterns

    • Compare expression levels across leaves, stems, roots, and reproductive structures

How does cemA from Ginkgo biloba compare to cemA from other plant species in terms of sequence, structure, and function?

Comparative analysis framework:

  • Sequence Conservation Across Plant Lineages:

    • Perform multiple sequence alignments of cemA from diverse plant species

    • Calculate percent identity and similarity scores

    • Identify conserved functional domains and variable regions

  • Evolutionary Rate Analysis:

    • Compare synonymous (Ks) and nonsynonymous (Ka) substitution rates

    • Ginkgo biloba has unique evolutionary patterns, with gene loss (e.g., one ycf2 copy) not significantly elevating Ks of retained genes

    • Compare with species showing accelerated evolutionary rates like Cyperaceae

  • Genomic Context Comparison:

    • Analyze location of cemA within chloroplast genomes across species

    • Compare adjacent genes and regulatory elements

    • Examine presence in IR vs. single-copy regions

Comparative Data Table (Hypothetical Based on Available Information):

SpeciescemA Length (aa)Genomic ContextNotable FeaturesPredicted Function
Ginkgo biloba261Chloroplast genomePart of quadripartite structureEnvelope membrane transport
Cycas taitungensis~260*Similar to GinkgoLarger chloroplast genome (163,403 bp)Similar to Ginkgo
Pinus taedaVariable*Reduced IR regionsSignificantly reduced chloroplast genomeMay have altered function
Arabidopsis thaliana~230*Angiosperms patternDifferent evolutionary historyWell-characterized transport

*Note: Exact lengths would need to be verified through sequence analysis; these are estimates based on related information in the search results.

What are the most advanced structural biology techniques that can be applied to study cemA protein structure and function?

For researchers seeking to analyze cemA structure at high resolution, several advanced techniques are applicable:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Particularly valuable for membrane proteins that resist crystallization

    • Can achieve near-atomic resolution without crystallization

    • Sample preparation involves vitrification in detergent micelles or nanodiscs

  • Integrative Structural Biology:

    • Combining multiple experimental techniques (e.g., crosslinking-MS, HDX-MS, SAXS)

    • Computational modeling using restraints from experimental data

    • Generates comprehensive structural models when single techniques are insufficient

  • Solid-State NMR:

    • Applicable to membrane proteins in native-like lipid environments

    • Can provide information on dynamics and conformational changes

    • Requires isotopic labeling of recombinant protein

  • Molecular Dynamics Simulations:

    • In silico approach to model protein behavior in membrane environment

    • Provides insights into conformational dynamics and substrate interactions

    • Can complement experimental structural data

  • Single-Particle Analysis:

    • For purified protein complexes containing cemA

    • Can reveal structural organization and protein-protein interfaces

    • Useful for understanding cemA in its native protein complex context

How can studies of Ginkgo biloba cemA contribute to our understanding of chloroplast evolution?

Ginkgo biloba represents a unique evolutionary lineage as a "living fossil" with origins dating back over 200 million years. Research on its cemA protein offers several valuable insights into chloroplast evolution:

  • Ancestral Features Preservation:

    • Ginkgo has maintained both inverted repeat regions while some gymnosperms have lost one or both

    • The cemA gene potentially preserves characteristics of ancient land plants

  • Evolutionary Rate Analysis:

    • Ginkgo shows unique patterns in evolutionary rates compared to other plant lineages

    • Studies can examine whether cemA follows the pattern where loss of duplicate genes doesn't significantly accelerate substitution rates in retained copies

  • Genome Structure Evolution:

    • The chloroplast genome of Ginkgo has unique structural features, including shortened IRs due to ycf2 loss

    • Placement of cemA relative to genome rearrangement hotspots can provide insights into chloroplast genome stability

  • Phylogenetic Signal Analysis:

    • cemA can be included in multi-gene analyses to resolve gymnosperm relationships

    • Helps determine whether Ginkgo is more closely related to cycads than to other gymnosperm groups

  • Functional Evolution Studies:

    • Comparing cemA function across diverse plant lineages can reveal evolutionary conservation or divergence of chloroplast envelope functions

    • May provide insights into adaptations of photosynthetic machinery during plant evolution

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.