Recombinant Glis glis ATP synthase protein 8 (MT-ATP8)

What is Recombinant Glis glis ATP synthase protein 8 and what are its basic structural properties?

Recombinant Glis glis ATP synthase protein 8 (MT-ATP8) is a mitochondrial-encoded protein derived from the Fat dormouse (Myoxus glis) that forms an essential subunit of the ATP synthase complex (Complex V). The protein consists of 67 amino acids with the sequence: MPQLDTSTWFTTILSTSFSIIHRLQLKLTTHIFSPNPTPKDLKTLKHHNPWDKKWTKSYLPLSLHQH .

It is commonly known by several alternative names including:

• ATP synthase protein 8

• A6L

• F-ATPase subunit 8

The protein is encoded by the MT-ATP8 gene (synonyms: ATP8, ATPASE8, MTATP8) and is cataloged in UniProt under the accession number O63902 .

How does MT-ATP8 from Glis glis compare to human MT-ATP8?

The Glis glis MT-ATP8 protein shares functional and structural similarities with human MT-ATP8, but with species-specific sequence variations. Both function as components of the ATP synthase complex, but researchers should note that:

• The human MT-ATP8 gene has been implicated in several mitochondrial disorders, making Glis glis MT-ATP8 a valuable comparative model .

• Both proteins are part of a highly conserved molecular machinery for ATP production.

• Study of species-specific variations can provide insights into adaptive evolution of mitochondrial energy production systems .

When designing cross-species experiments, researchers should account for these differences, particularly when developing antibodies or designing protein interaction studies.

What are the optimal storage and handling conditions for Recombinant Glis glis MT-ATP8?

For optimal preservation of protein integrity and activity, researchers should follow these evidence-based protocols:

• Store the protein at -20°C for routine use, or at -80°C for extended storage periods

• Prepare the protein in a Tris-based buffer with 50% glycerol for stability

• Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

• For working experiments, store aliquots at 4°C for no more than one week

• When conducting experiments requiring extended manipulation, maintain samples on ice

These conditions maintain the structural integrity and functional activity of the recombinant protein, which is critical for reliable experimental outcomes.

How can researchers effectively incorporate MT-ATP8 into functional ATP synthase studies?

When studying MT-ATP8 function within the ATP synthase complex, consider these methodological approaches:

• In vitro reconstitution studies: Incorporate purified recombinant MT-ATP8 into proteoliposomes with other ATP synthase subunits to assess assembly and function.

• Bioenergetic assays: Utilize Seahorse analysis to measure oxygen consumption rates (OCR) and evaluate OXPHOS function when studying the impact of MT-ATP8 variants .

• Blue native polyacrylamide gel electrophoresis (BN-PAGE): Essential for analyzing ATP synthase complex assembly and integrity. This method has successfully shown that mutations in MT-ATP8 can lead to "lack of holocomplex V and increased amounts of mitochondrial ATP synthase subcomplexes" .

• In-gel activity assays: These can detect ATP hydrolysis activity of free F1-ATPase and other subcomplexes when MT-ATP8 function is compromised .

• Allotopic expression systems: For comparative studies, researchers can use allotopic expression (nuclear expression of mitochondrial genes) as demonstrated in recent mouse models to study MT-ATP8 function .

How can Recombinant Glis glis MT-ATP8 be used in mitochondrial disease modeling?

Recombinant Glis glis MT-ATP8 provides valuable opportunities for modeling mitochondrial disorders for several reasons:

• The protein can be incorporated into studies investigating pathogenic variants similar to human MT-ATP8 mutations associated with conditions such as:

  • NARP syndrome (Neuropathy, Ataxia, and Retinitis Pigmentosa)

  • Leigh syndrome

  • Episodic weakness and progressive neuropathy

  • Hypertrophic cardiomyopathy

• In research models, MT-ATP8 can be used to study the following disease processes:

• Research methodologies should include:

  • Creation of patient-derived cybrid cell lines

  • Analysis of variant-specific complex V assembly defects

  • Measurement of ATP synthesis capacity in various cell types and tissues

What experimental approaches can differentiate between pathogenic and benign variants in MT-ATP8?

To differentiate between pathogenic and benign variants in MT-ATP8, researchers should employ a multi-faceted approach:

• Yeast modeling system: The S. cerevisiae model has proven effective for studying MT-ATP8 variants. Researchers can introduce equivalent mutations to human variants into yeast ATP8 gene and assess:

  • Growth on non-fermentable carbon sources

  • Oxygen consumption

  • ATP synthase assembly and function

• Biochemical characterization: Studies should include:

  • Blue native PAGE to assess complex V assembly

  • In-gel activity assays for ATP hydrolysis

  • Measurement of oxygen consumption and ATP production rates

• Structural analysis: Using recently available complete structures of ATP synthases from different organisms to:

  • Analyze the membrane part of subunit 8 which is structurally preserved across species

  • Model substitutions in this region and predict functional consequences

• Pathogenicity scoring: Available data suggests variability in pathogenic potential:

This integrated approach enables researchers to more accurately determine the functional consequences of MT-ATP8 variants .

What are the common challenges in expressing and purifying functional Recombinant Glis glis MT-ATP8?

Researchers face several technical challenges when working with recombinant MT-ATP8:

• Hydrophobicity: As a mitochondrial membrane protein, MT-ATP8 contains hydrophobic regions that can cause aggregation during expression and purification.

• Small size: At only 67 amino acids, MT-ATP8 can be difficult to express in sufficient quantities and detect through standard methods.

• Native conformation: Maintaining the proper folding of MT-ATP8 outside its natural complex is challenging.

To address these issues, researchers should:

• Use specialized expression systems optimized for membrane proteins

• Consider fusion tags that enhance solubility while preserving function

• Employ detergent-based purification strategies appropriate for membrane proteins

• Validate protein functionality through complex V assembly assays rather than relying solely on yield

How can researchers effectively study the interaction between MT-ATP8 and other ATP synthase subunits?

To study interactions between MT-ATP8 and other subunits of the ATP synthase complex, researchers can employ these techniques:

• Co-immunoprecipitation (Co-IP): Using epitope-tagged recombinant MT-ATP8 to pull down interacting partners from mitochondrial extracts.

• Crosslinking mass spectrometry: To identify precise interaction sites between MT-ATP8 and neighboring subunits.

• FRET-based assays: For studying dynamic interactions in real-time within intact mitochondria.

• Allotopic expression with epitope tags: Recent research has successfully used this approach to study MT-ATP8 integration into the ATP synthase complex:

"We generated a transgenic mouse with an epitope-tagged recoded mitochondrial-targeted ATP8 gene expressed from the ROSA26 locus in the nucleus... The allotopically expressed ATP8 protein in transgenic mice was constitutively expressed across all tested tissues, successfully transported into the mitochondria, and incorporated into ATP synthase" .

• Cryo-EM structural studies: When combined with targeted mutations or crosslinking, this can reveal the structural basis of MT-ATP8 interactions within the complex.

What is the relationship between recombinant MT-ATP8 studies and research on GLIS transcription factors?

It's important to clarify a potential source of confusion in the literature: "Glis glis" refers to the fat dormouse species from which the MT-ATP8 protein in question is derived, while "GLIS" (Gli-Similar) proteins constitute a distinct subfamily of Krüppel-like zinc finger transcription factors .

Despite this nomenclature similarity, there are interesting research intersections:

• Mitochondrial function regulation: GLIS3 has recently been identified as a transcriptional regulator of mitochondrial functions:

"GLIS3 is associated with the regulatory region of many [mitochondrial] genes... GLIS3 regulates transcription of many metabolic and mitochondrial function-related genes in coordination with these TFs [transcription factors]" .

• Energy metabolism: GLIS3 regulates genes critical for mitochondrial biogenesis and oxidative phosphorylation, potentially including nuclear-encoded ATP synthase components:

"Transcriptome analysis showed that many genes critical for mitochondrial biogenesis, oxidative phosphorylation (OXPHOS), fatty acid oxidation (FAO), and the tricarboxylic acid (TCA) cycle, including Tfam, Tfb1m, Tfb2m, Ppargc1a, Ppargc1b, Atp5j2, Hadha, and Sdha, are significantly suppressed in kidneys from both ubiquitous and tissue-specific *Glis3-*deficient mice" .

• Research opportunity: Investigations into how GLIS transcription factors might regulate expression of nuclear-encoded ATP synthase components that interact with MT-ATP8 could represent an emerging research direction.

How can allotopic expression approaches advance functional studies of MT-ATP8?

Allotopic expression—the nuclear expression of mitochondrially-encoded genes—represents a promising research approach for studying MT-ATP8 function and potential therapeutic applications:

• Recent breakthrough: A 2024 study successfully demonstrated allotopic expression of ATP8 in a transgenic mouse model:

"We used a mouse strain C57BL/6J(mtFVB) with a natural polymorphism (m.7778 G>T) in the mitochondrial ATP8 gene that encodes a protein subunit of the ATP synthase. We generated a transgenic mouse with an epitope-tagged recoded mitochondrial-targeted ATP8 gene expressed from the ROSA26 locus in the nucleus" .

• Key methodological considerations:

  • Codon optimization for nuclear expression

  • Addition of appropriate mitochondrial targeting sequences (MTS)

  • Use of epitope tags for tracking and quantification

  • Selection of appropriate promoters for tissue-specific expression

• Research applications:

  • Modeling MT-ATP8 variants in vivo

  • Rescue studies for MT-ATP8 defects

  • Structural and functional investigations in the native environment

• Quantitative findings: The research demonstrated successful integration of nuclear-expressed ATP8:

"It is evident that the transgenic oATP8 is approximately twice the amount of the endogenous ATP8 in the C57BL/6J(mtFVB) transgenic mice relative to C57BL/6J(mtC57BL/6J) transgenic mice, suggesting better incorporation of oATP8 in the FVB mitochondria" .

This approach opens new avenues for studying MT-ATP8 function and potential therapeutic applications for mitochondrial disorders.

How do MT-ATP8 variants contribute to mitochondrial disease pathogenesis?

MT-ATP8 variants can cause disease through several mechanisms:

• Assembly defects: Mutations can prevent proper integration of MT-ATP8 into the ATP synthase complex, leading to incomplete assembly and accumulation of subcomplexes:

"Immunoblotting after blue native polyacrylamide gel electrophoresis showed a lack of holocomplex V and increased amounts of mitochondrial ATP synthase subcomplexes" .

• Proton translocation disruption: Some variants affect the interaction between MT-ATP8 and other subunits critical for proton movement across the inner mitochondrial membrane.

• Energy production deficiency: The ultimate consequence is reduced ATP production, particularly impacting high-energy demanding tissues like brain, muscle, and heart.

• Clinical manifestations: MT-ATP8 variants have been associated with diverse clinical presentations:

Recent research indicates significant clinical variability among patients with similar mutation loads, complicating genotype-phenotype correlations .

What methodological approaches are most effective for studying MT-ATP8 in the context of mitochondrial disease research?

For effective MT-ATP8 disease research, scientists should consider these methodological approaches:

• Patient cohort studies: A multicenter approach has proven valuable:

"In this study, we retrospectively collected data from a cohort of 111 patients with MT-ATP6/8 deficiency, including 98 previously unreported patients, with the main goal of analyzing morbidity, mortality, and other clinical and biochemical parameters useful for clinical trial design" .

• Comprehensive registry analysis: Utilizing international mitochondrial disease registries provides access to larger, well-characterized patient populations:

"The multicentric study was conducted by selecting patients with confirmed genetic diagnosis of MT-ATP6/8 deficiency from the German (mitoNet) and Italian (MITOCON and MIRE2020) registries for patients with confirmed mitochondrial disorders" .

• Functional studies using multiple approaches:

  • Cybrid cell lines containing patient mtDNA

  • Yeast models with equivalent mutations

  • Allotopic expression of variant and wild-type genes

  • Blue native PAGE for complex assembly analysis

• Natural history data collection: This approach provides valuable insights into disease progression and potential therapeutic targets:

"This article presents an international multicenter study designed to provide a retrospective natural history of patients with MT-ATP6/8 deficiency and to identify primary and secondary end points for future clinical trials" .