Recombinant Gloeobacter violaceus ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Molecular Definition and Functional Role

The atpB gene encodes subunit a, a hydrophobic protein essential for forming the proton channel in the F₀ sector of ATP synthase. In Gloeobacter violaceus (strain PCC 7421), this subunit facilitates proton movement across the membrane, driving the rotation of the F₁ sector and enabling ATP synthesis . The recombinant version is expressed in E. coli with an N-terminal His tag (Q7NCR8) to enhance solubility and purification efficiency .

Key Features:

ParameterDetailsSource
UniProt IDQ7NCR8
AA Sequence (1-246)MELALATLGNQPLIAAVEVGKHLTWQLGPLSVHGQTMITTWVVmLLLIGLTFIGTRKLQR...
Molecular Weight~27.5 kDa (predicted)
Gene Locusgll2910

Production and Purification

The recombinant protein is produced via heterologous expression in E. coli, leveraging its simplicity for large-scale production.

Production Specifications:

ParameterDetailsSource
Host OrganismE. coli
TagN-terminal His tag
Storage BufferTris-based buffer, 50% glycerol
Storage Conditions-20°C (long-term), 4°C (short-term)

Applications:

  • Biochemical Assays: ATP hydrolysis/synthesis activity measurements .

  • ELISA: Antigen in immunoassays for studying ATP synthase regulation .

Research Findings and Mechanistic Studies

Subunit a’s role in proton translocation is central to ATP synthase function. Studies in related cyanobacteria (e.g., Synechocystis PCC 6803) reveal that ATP synthase activity is regulated by environmental cues:

ConditionImpact on ATP Synthase ActivitySource
DarknessInduces AtpΘ expression to inhibit ATP hydrolysis .
Proton GradientSustains ATP synthesis; collapse triggers AtpΘ-mediated inhibition

Functional Studies:

  • Knockout Experiments: Deletion of atpT (encoding AtpΘ) abolishes darkness-induced inhibition of ATPase activity .

  • Purified ATP Synthase: Recombinant subunit a, when incorporated into purified complexes, enables direct measurement of proton-driven ATP synthesis .

Interaction Partners and Regulatory Networks

Subunit a interacts with multiple components of the ATP synthase complex, as identified through co-immunoprecipitation and far-Western blotting .

Interaction Partners:

SubunitRole in ATP Synthase ComplexSource
Subunit c (atpE)Forms proton-binding site with subunit a
Subunit β (atpB)Catalytic subunit for ATP synthesis

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please include them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein orders are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form maintains a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development according to your specification.
Synonyms
atpB; atpI; gll2910; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-246
Protein Length
full length protein
Species
Gloeobacter violaceus (strain PCC 7421)
Target Names
atpB
Target Protein Sequence
MELALATLGNQPLIAAVEVGKHLTWQLGPLSVHGQTMITTWVVMLLLIGLTFIGTRKLQR VPSGLQNFLEYAYDLLASIARNQIGEKQYRSWVPLIGTIFLFVLFANWLGQLPLRLFHIP EGELASPTNDINTTVALSLIALVSYIYAGLRKSGFGYFKHYFESPILAAVWVLEFFTRPL SLSIRLFGNILAEELVVAVLILLVPILVPVPLMILFLLTGAIQALVFSTLTASYVGEAVE DHDDHH
Uniprot No.

Target Background

Function
ATP synthase subunit a (atpB) is a crucial component of the proton channel, playing a direct role in the translocation of protons across the membrane.
Database Links

KEGG: gvi:gvip403

STRING: 251221.gvip403

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.