Recombinant Gloeobacter violaceus Cytochrome b6-f complex iron-sulfur subunit (petC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petC; glr3038; Cytochrome b6-f complex iron-sulfur subunit; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein; ISP; RISP; Rieske iron-sulfur protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Gloeobacter violaceus (strain PCC 7421)
Target Names
petC
Target Protein Sequence
MSESAAQEIPMSRRQLLSFVTGGAIAATTAATLYPVVLYFLPPSTAGGGEGVAAKDKEGK DISVSKLLAAATPGEPVLTLGLDVNGGDATYIVINDQKEIANFGINAVCTHLGCVVPWDN GAKQFKCPCHGSVYNADGGLERGPAPQPLALVKATVSDDKVLIAPWTEQDFRCTDLWCNK DPYWVK
Uniprot No.

Target Background

Function

This protein is a component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Database Links

KEGG: gvi:gvip416

STRING: 251221.gvip416

Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the Gloeobacter violaceus cytochrome b6-f complex and why is it significant for research?

The cytochrome b6-f complex is an essential membrane protein complex involved in photosynthetic and respiratory electron transport. It functions as a plastoquinone-plastocyanin oxidoreductase (EC 1.10.9.1), facilitating electron transfer between photosystems II and I in oxygenic photosynthesis. The iron-sulfur subunit (petC) contains a Rieske iron-sulfur cluster critical for electron transfer.

Gloeobacter violaceus PCC 7421 is particularly significant because it's considered one of the most primitive cyanobacteria, lacking thylakoid membranes, with photosynthetic components localized in the cytoplasmic membrane instead . This unique characteristic makes its photosynthetic machinery, including the cytochrome b6-f complex, valuable for understanding the evolution of oxygenic photosynthesis .

What expression systems are optimal for producing recombinant G. violaceus petC?

Escherichia coli is the most commonly used expression system for recombinant G. violaceus petC. Research indicates that a bicistronic design (BCD) system combining a constitutive promoter with tunable translation initiation elements significantly improves membrane protein production compared to traditional inducible systems .

For optimal expression of G. violaceus petC:

  • BCD elements should be inserted into the expression vector using a golden gate-based cloning method .

  • Medium-strength BCD elements (like BCD19) typically yield higher production levels for membrane proteins compared to stronger elements .

  • E. coli strain selection is critical - systems like BCD can provide at least 2-fold higher volumetric production than optimized Lemo21(DE3) systems .

For example, a comparative study of membrane protein production methods showed:

Expression SystemRelative Production LevelCell PopulationInclusion Body Formation
BCD19-based2x higherHomogeneousReduced
Lemo21(DE3)BaselineNon-homogeneousHigher
pET-basedLowerMixedHigher

What purification methods yield the highest purity and activity for recombinant petC?

A multi-step purification protocol is recommended for obtaining high-purity, active petC:

  • Cell lysis and membrane isolation: Cells are harvested by centrifugation, resuspended in an appropriate buffer, and lysed via sonication or mechanical disruption. Membranes are isolated by ultracentrifugation .

  • Solubilization: Membranes are solubilized with 1% n-Dodecyl-β-D-Maltopyranoside (DDM) . This detergent effectively solubilizes membrane proteins while preserving their structure and function.

  • Affinity chromatography: When expressed with a His-tag, petC can be purified using Ni²⁺-NTA agarose affinity chromatography. The column is equilibrated with buffer containing 0.02% DDM and appropriate imidazole concentrations for binding, washing, and elution stages .

  • Final purification: Size exclusion chromatography can be employed as a final polishing step to remove aggregates and further increase purity.

The purified protein should be stored in buffer containing 0.02% DDM at -20°C for short-term storage or -80°C for extended storage, with 50% glycerol as a cryoprotectant .

How can the activity of recombinant G. violaceus petC be measured and validated?

Multiple complementary techniques can be employed to validate the functionality of recombinant petC:

  • Spectroscopic analysis: The iron-sulfur cluster in active petC exhibits characteristic absorption spectra, with peaks in the visible region. UV-visible spectroscopy can confirm proper folding and incorporation of the iron-sulfur cluster.

  • Electron transfer assays: Activity can be measured using artificial electron donors and acceptors. For the complete cytochrome b6-f complex, plastoquinol oxidation coupled to cytochrome c reduction can be monitored spectrophotometrically.

  • EPR spectroscopy: Electron paramagnetic resonance spectroscopy can be used to characterize the redox state and environment of the iron-sulfur cluster in petC.

  • Membrane reconstitution experiments: Reconstitution of purified petC into liposomes can help assess its functionality in a membrane environment.

  • Proton pumping assays: For the complete cytochrome b6-f complex, proton pumping activity can be measured in reconstituted proteoliposomes or sphaeroplast membranes using pH-sensitive dyes or a pH meter .

How does the function of G. violaceus petC differ from that of other cyanobacteria?

G. violaceus lacks thylakoid membranes, which forces its entire photosynthetic apparatus, including the cytochrome b6-f complex, to operate within the cytoplasmic membrane . This unique cellular organization presents several functional distinctions:

  • Altered electron transport dynamics: The absence of thylakoid compartmentalization may affect the spatial organization of electron transport components and potentially the kinetics of electron transfer.

  • Compensatory mechanisms: G. violaceus employs additional energy-generating mechanisms to compensate for potentially less efficient photosynthesis. For example, it expresses Gloeobacter rhodopsin (GR), a light-driven proton pump that can generate a proton gradient independent of the photosynthetic electron transport chain .

  • Core conservation with evolutionary distinctions: Despite these differences, the core components of the cytochrome b6-f complex, including petC, remain highly conserved, underscoring the fundamental importance of this complex in photosynthesis .

What insights does G. violaceus petC provide about the evolution of photosynthesis?

G. violaceus is considered to represent one of the earliest diverging lineages of cyanobacteria based on 16S rRNA phylogeny . Analysis of its petC and other photosynthetic components offers several evolutionary insights:

  • Core gene conservation: The petC gene is part of a core set of 323 genes that have remained relatively stable throughout cyanobacterial evolution, suggesting strong selective pressure against horizontal gene transfer for these essential components .

  • Ancient photosynthetic apparatus: The cytochrome b6-f complex components in G. violaceus represent an ancient form of the photosynthetic apparatus, providing a window into early photosynthetic mechanisms.

  • Ancestral state characteristics: The unique characteristics of G. violaceus, including its lack of thylakoids and the organization of its photosynthetic machinery in the cytoplasmic membrane, may represent ancestral states in the evolution of oxygenic photosynthesis .

  • Genomic evidence: Comparative genomic analyses reveal that cytochrome b6-f subunits (PetA, PetB, PetC, PetD, PetG, PetM, PetN) are conserved across all cyanobacteria and plants but show variable distribution in anoxygenic phototrophs, highlighting their specific importance in oxygenic photosynthesis .

How does the structure of petC contribute to understanding photosynthetic electron transport evolution?

The structure and function of petC offer several insights into the evolution of photosynthetic electron transport:

  • Conserved domains: The petC protein contains highly conserved cysteine residues that coordinate the [2Fe-2S] cluster, a structural feature maintained across vast evolutionary distances from cyanobacteria to plants.

  • Protein-protein interactions: Genome-wide conserved small gene clusters often encode proteins that interact physically or functionally. The conservation of these clusters containing petC and other cytochrome b6-f components suggests strong evolutionary pressure to maintain these specific protein-protein interactions .

  • Structural adaptations: Comparing petC from G. violaceus with those from other organisms reveals subtle structural adaptations that may reflect evolutionary optimization for different cellular environments and energy transfer requirements.

  • Core complex stability: The remarkably stable evolutionary trajectory of petC and other photosynthetic proteins suggests that the macromolecular interactions in these complex structures create a selection pressure that restricts piecemeal horizontal gene transfer .

How can site-directed mutagenesis of G. violaceus petC inform structure-function relationships?

Site-directed mutagenesis of conserved residues in petC can provide valuable insights into structure-function relationships:

  • Iron-sulfur cluster coordination: Mutations of the conserved cysteine residues that coordinate the [2Fe-2S] cluster would disrupt electron transfer function and help map the electron transfer pathway.

  • Interface residues: Mutating amino acids at the interface with other cytochrome b6-f subunits can elucidate the structural requirements for complex assembly and stability.

  • Comparative mutational analysis: Creating equivalent mutations in petC from G. violaceus and other cyanobacteria can reveal how structural differences influence function in these evolutionarily distinct organisms.

  • Redox potential modulation: Mutations in the vicinity of the iron-sulfur cluster can alter its redox potential, providing insights into how the protein environment tunes electron transfer properties.

A systematic mutational approach should target:

  • Conserved residues identified through sequence alignment

  • Residues predicted to be involved in protein-protein interactions

  • Amino acids in the vicinity of the iron-sulfur cluster

  • Regions with unusual structural features specific to G. violaceus

What experimental challenges exist in reconstituting functional cytochrome b6-f complex with recombinant petC?

Reconstitution of a functional cytochrome b6-f complex presents several challenges:

  • Multi-subunit assembly: The complete complex contains multiple subunits (PetA, PetB, PetC, PetD, PetG, PetL, PetM, PetN) that must assemble correctly . Ensuring proper stoichiometry and interaction of these components is technically challenging.

  • Cofactor incorporation: Besides the iron-sulfur cluster in petC, the complex contains multiple heme cofactors that must be correctly incorporated during assembly.

  • Membrane environment: The complex functions within a lipid membrane. Reconstitution requires appropriate lipid composition to support proper folding and function.

  • Protein stability: Membrane proteins like those in the cytochrome b6-f complex are often unstable when removed from their native membrane environment. Maintaining protein stability throughout purification and reconstitution is challenging.

  • Functional validation: Confirming that the reconstituted complex is fully functional requires sophisticated biophysical techniques to measure electron transfer and proton translocation.

Researchers have addressed these challenges using approaches like:

  • Co-expression of multiple subunits using polycistronic constructs

  • Optimization of detergent and lipid composition

  • Development of rapid purification protocols to minimize protein degradation

  • Employment of nanodiscs or liposomes for reconstitution in membrane-like environments

What are the most common issues in heterologous expression of G. violaceus petC and how can they be resolved?

Several challenges commonly arise during heterologous expression of G. violaceus petC:

  • Inclusion body formation: As a membrane-associated protein, petC has hydrophobic regions that can lead to inclusion body formation.

    • Solution: Optimize expression conditions (lower temperature, reduced inducer concentration), use solubility-enhancing fusion tags, or employ specialized E. coli strains designed for membrane protein expression .

  • Improper folding and iron-sulfur cluster incorporation: The [2Fe-2S] cluster is essential for function but may not incorporate properly in heterologous systems.

    • Solution: Co-express iron-sulfur cluster assembly proteins, supplement growth media with iron, and optimize aerobic/anaerobic conditions to promote proper cluster assembly.

  • Proteolytic degradation: Improperly folded proteins are often targets for host proteases.

    • Solution: Include protease inhibitors during purification, use protease-deficient host strains, or optimize expression conditions to reduce misfolding.

  • Toxicity to host cells: Overexpression of membrane proteins can disrupt host cell membrane integrity.

    • Solution: Use tightly controlled inducible promoters, tune expression levels with BCD elements, or employ specialized hosts adapted for membrane protein expression .

  • Low yield: Membrane proteins often express at lower levels than soluble proteins.

    • Solution: Scale up culture volume, optimize media composition, or use high cell-density fermentation techniques.

How should researchers address contradictory results when comparing G. violaceus petC with homologs from other species?

When faced with contradictory results when comparing G. violaceus petC with homologs from other species, researchers should consider:

  • Evolutionary context: G. violaceus is phylogenetically distinct from most model cyanobacteria, potentially explaining functional differences. Compare results against the known evolutionary relationships and consider whether differences reflect adaptation to different cellular environments .

  • Methodological variations: Systematic analysis of experimental conditions is crucial:

    • Expression systems and conditions used for each protein

    • Purification methods and buffer compositions

    • Assay conditions (temperature, pH, salt concentration)

    • Presence of detergents or lipids that may affect protein behavior

  • Protein integrity verification: Before concluding biological differences exist, verify:

    • Protein folding (using spectroscopic methods)

    • Cofactor incorporation (iron-sulfur cluster presence)

    • Oligomeric state (size-exclusion chromatography or light scattering)

    • Post-translational modifications

  • Cellular context consideration: G. violaceus lacks thylakoids, so its petC functions in a different membrane environment than that of other cyanobacteria. This contextual difference may explain functional variations .

  • Independent validation: Employ multiple complementary techniques to validate observations and consider collaborations to replicate key findings in different laboratories.

How might G. violaceus petC be utilized in synthetic biology applications?

G. violaceus petC has several potential applications in synthetic biology:

  • Minimal photosynthetic systems: As part of an evolutionarily ancient photosynthetic apparatus, G. violaceus petC could contribute to engineering minimal, efficient photosynthetic modules for integration into non-photosynthetic organisms.

  • Electron transport engineering: The iron-sulfur cluster in petC makes it valuable for engineering novel electron transport chains with applications in bioenergy production or bioremediation.

  • Membrane protein expression platforms: Insights from successful expression of G. violaceus petC can inform development of improved platforms for membrane protein production, a persistent challenge in biotechnology .

  • Light-driven proton pumping systems: Combined with other components like Gloeobacter rhodopsin, petC could contribute to engineered systems for light-driven ATP synthesis or secondary active transport .

  • Evolutionary synthetic biology: Using G. violaceus components as evolutionary starting points, researchers could recapitulate or reimagine the evolution of complex photosynthetic systems, providing both fundamental insights and novel biotechnological tools.

What emerging technologies might enhance our understanding of G. violaceus petC function and evolution?

Several emerging technologies hold promise for advancing our understanding of G. violaceus petC:

  • Cryo-electron microscopy: High-resolution structures of the entire cytochrome b6-f complex from G. violaceus could reveal unique features related to its primitive evolutionary status and membrane localization.

  • Single-molecule techniques: Methods like single-molecule FRET could track electron transfer dynamics through petC in real-time, providing unprecedented insights into its functional mechanism.

  • Advanced genomics and phylogenetics: Continued sequencing of diverse cyanobacterial lineages will refine our understanding of petC evolution and potentially identify additional primitive forms for comparative analysis.

  • Synthetic evolutionary biology: Reconstructing ancestral petC sequences based on phylogenetic inference could provide functional insights into evolutionary transitions.

  • In-cell structural biology: Techniques like in-cell NMR or super-resolution microscopy could examine petC structure and dynamics in its native environment.

  • Computational approaches: Advanced molecular dynamics simulations incorporating quantum effects could model electron transfer through the iron-sulfur cluster with greater accuracy, potentially revealing subtle functional adaptations.

  • Optogenetic applications: Integration of light-responsive elements with petC function could enable precise temporal control of electron transfer for both research and biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.