Recombinant Gloeobacter violaceus Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petD; gll1918; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-159
Protein Length
full length protein
Species
Gloeobacter violaceus (strain PCC 7421)
Target Names
petD
Target Protein Sequence
MPLKRPELDDPEIRELLEQGMGHNTYGEPFWPNDILIFGVVILGTIFGVIALAVLDPAKM GEPADPFNTPLHILPEWYFYPVFQILRVVPNKLLGVVLMAAIPIGLALVPFIENVNKFQN PFRRPLATAVFLIGTVVTMYLGIGAMIPDIPKSLTLGLF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links

KEGG: gvi:gvip264

STRING: 251221.gvip264

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Cytochrome b6-f complex in Gloeobacter violaceus and how does it differ from other cyanobacteria?

The Cytochrome b6-f complex is a membrane-embedded protein complex that plays a critical role in photosynthetic electron transport. Unlike most cyanobacteria where this complex is located in thylakoid membranes, in Gloeobacter violaceus it is found in the cytoplasmic membrane since this organism lacks thylakoid membranes entirely . This means processes such as oxygen evolution and electron transfer mediated by cytochrome c553 and plastocyanin occur in the periplasm instead of the lumen.

Gloeobacter violaceus has several distinctive features:

  • It possesses two petB genes (petB1 and petB2) and two petD genes, each organized in an operon, which is unusual as most cyanobacteria have only one copy of these genes

  • Genes for several photosystem components (PsaI, PsaJ, PsaK, PsaX for PSI and PsbY, PsbZ, Psb27 for PSII) are missing, while others (PsaF, PsbO, PsbU, PsbV) are poorly conserved

  • The phycobilisome structure differs from other cyanobacteria, with phycobiliproteins forming rod-shaped elements in bundle-shaped aggregates situated vertically adjacent to the inner surface of the cytoplasmic membrane

  • Sulfoquinovosyl diacylglycerol (SQDG), important for photosystem stabilization in other organisms, is absent in Gloeobacter, while polyunsaturated fatty acids (PUFA) content is high

What is the structure and function of the petD gene product in the Cytochrome b6-f complex?

The petD gene encodes subunit IV (PetD) of the Cytochrome b6-f complex. This protein is essential for the assembly and function of the complex:

  • PetD forms a mildly protease-resistant subcomplex with Cytochrome b6 (PetB) that serves as a template for the assembly of other subunits like Cytochrome f (PetA) and PetG

  • The N-terminal region of PetD contains a phosphorylation site at T4, which is targeted by the STT7 kinase and plays a regulatory role in the complex's function

  • PetD becomes unstable in the absence of Cytochrome b6, and similarly, the synthesis of Cytochrome f is greatly reduced when either Cytochrome b6 or PetD is inactivated

  • In Gloeobacter violaceus specifically, there are two petD genes, each organized in an operon with a petB gene, creating a unique genetic redundancy not observed in other cyanobacteria

What methods are commonly used to study the Cytochrome b6-f complex and its subunits?

Several experimental methods are employed to study the Cytochrome b6-f complex:

Genetic Engineering Approaches:

  • Site-directed mutagenesis to create specific mutations (e.g., phosphomimic mutation PetD T4E or N-terminal amino acid deletions)

  • Gene knockout or silencing strategies to analyze loss-of-function phenotypes

Biochemical and Biophysical Techniques:

  • Spectroscopic analysis to study heme binding and characteristics

  • Electrochromic shift (ECS) measurements at 520 nm to assess electrogenicity and Q-cycle activity

  • Redox kinetics studies analyzing electron transfer under oxic versus anoxic conditions

Protein Analysis Methods:

  • Immunoblotting with specific antibodies to detect and quantify proteins

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE) to analyze assembly states (dimer, monomer, intermediate)

  • Pulse-chase experiments to study synthesis and stability of newly synthesized proteins

  • Ribosome profiling to analyze translation efficiency

How do you design basic experiments to evaluate petD expression and function?

When designing experiments to evaluate petD expression and function, researchers should follow these methodological steps:

Experimental Design Process:

  • Formulate a testable hypothesis about petD expression or function

  • Identify independent and dependent variables :

    • Independent: Genetic modifications, environmental conditions

    • Dependent: Complex assembly, electron transport rate, growth rate

  • Control variables that could affect results (temperature, light intensity, media composition)

  • Select appropriate methods for data collection based on the aspect being studied:

    • For expression: qRT-PCR, western blotting, or reporter gene fusions

    • For function: Spectroscopic measurements, growth assays, or electron transport assays

Sample Experimental Design Table:

Treatment GrouppetD GenotypeLight ConditionsMeasurement ParametersSampling Times
ControlWild-typeNormal (100 μE)Growth, O₂ evolution, Complex assembly0, 24, 48, 72h
Experimental 1T4E mutationNormal (100 μE)Growth, O₂ evolution, Complex assembly0, 24, 48, 72h
Experimental 2ΔN-terminusNormal (100 μE)Growth, O₂ evolution, Complex assembly0, 24, 48, 72h
Control-HLWild-typeHigh (500 μE)Growth, O₂ evolution, Complex assembly0, 24, 48, 72h
Experimental 1-HLT4E mutationHigh (500 μE)Growth, O₂ evolution, Complex assembly0, 24, 48, 72h
Experimental 2-HLΔN-terminusHigh (500 μE)Growth, O₂ evolution, Complex assembly0, 24, 48, 72h

What is the role of the N-terminal region of PetD in the function of the Cytochrome b6-f complex?

The N-terminal region of PetD plays crucial roles in both electron transport and regulatory functions:

Regulatory Function:

  • The N-terminal domain contains a phosphorylation site at T4 that is targeted by the STT7 kinase

  • The phosphomimic mutation PetD T4E inhibits STT7 kinase activity, as indicated by the absence of STT7-dependent phosphorylation and the strain being locked in State 1

  • This reveals a novel feedback mechanism regulating phosphorylation facilitated by STT7

Electron Transport Function:

  • Deletion of five N-terminal amino acids (ΔN) results in inhibition of STT7 activity and disruption of electron transfer

  • ECS rise from Q-cycle activity is impaired in the ΔN mutant, despite the presence of heme c6f (the terminal electron acceptor in the low-potential chain)

  • In the ΔN mutant, b-heme oxidation slows approximately 20-fold, while cytochrome-f reduction slows 10-fold, indicating Qi-site impairment affecting the Qo-site

  • Under anoxic conditions, the ΔN mutant shows a redox-inactive low-potential chain causing a 25-fold slowdown in the high-potential chain

These findings collectively demonstrate that the N-terminal region of PetD is essential for both electron transport functionality and regulatory processes of the Cytochrome b6-f complex.

How do defects in the Cytochrome b6-f complex affect photosynthetic gene expression and electron transport?

Defects in the Cytochrome b6-f complex have significant downstream effects on both photosynthetic gene expression and electron transport:

Gene Expression Effects:

  • Mutants with defects in the Cytochrome b6-f complex show abolished or strongly reduced light induction of tetrapyrrole biosynthetic genes

  • This effect is specific to Cytochrome b6-f complex mutations, as mutants with defects in Photosystem II, Photosystem I, or plastocyanin show normal induction of chlorophyll biosynthesis genes

  • The redox state of the plastoquinone pool does not appear to control light induction of these chlorophyll biosynthetic genes

Electron Transport Effects:

  • The P1-15 mutant shows only a small absorption change in the slow phase of the flash-induced electrochromic shift measured at 520 nm, suggesting a very slow rate of electron transfer via the Cytochrome b6-f complex

  • Different types of mutations affect electron transport differently:

    • petA deletion (affecting cytochrome f) eliminates electron transport

    • petD-PWYE mutation (substitutions in three residues of subunit IV) inactivates the Q-O site where plastoquinol oxidation occurs

    • petC-Δ1 mutation (deletion in the PETC gene encoding the Rieske Fe-S protein) leads to a complete absence of this essential subunit

This research demonstrates that the Cytochrome b6-f complex plays a critical role in both electron transport and retrograde signaling that affects nuclear gene expression.

What are the unique characteristics and functions of the two petD genes in Gloeobacter violaceus?

Gloeobacter violaceus is unique among cyanobacteria in possessing two petB genes (petB1 and petB2) and two petD genes, each organized in an operon . This unusual genetic redundancy has several implications:

Genetic Organization:

  • The two petB-petD operons may have arisen through gene duplication events

  • Each petB gene is organized in an operon together with a petD gene, suggesting coordinated expression of the corresponding subunits

Functional Characteristics:

  • Both PetB proteins (PetB1 and PetB2) bind heme with high affinity, and their spectroscopic characteristics are distinctive for cytochrome b6 proteins

  • PetB2 differs from PetB1 in that one histidine residue corresponding to H100 (which serves as an axial ligand for heme b in PetB1) is mutated

  • Despite this difference, both PetB proteins bind two heme molecules with different midpoint potentials

  • When a histidine residue was introduced at the position corresponding to H100 in PetB1 to recreate the canonical heme b binding cavity in PetB2, the resulting protein variant showed altered properties

Evolutionary and Functional Implications:

  • The presence of two functional cytochrome b6-f pathways may provide Gloeobacter violaceus with advantages under different environmental conditions or stress scenarios

  • This redundancy might compensate for the lack of thylakoid membranes by allowing specialized functions or locations for each complex

  • The evolutionary history of these duplicate genes could provide insights into the early evolution of photosynthesis, as Gloeobacter is considered one of the earliest diverging lineages of cyanobacteria

What are the technical challenges in expressing and purifying recombinant Gloeobacter violaceus PetD for structural and functional studies?

Expressing and purifying recombinant Gloeobacter violaceus PetD presents several technical challenges:

Expression System Selection:

  • Choosing between heterologous systems (E. coli, yeast) versus homologous cyanobacterial systems

  • In heterologous systems, codon optimization may be necessary due to the high GC content (62%) of the Gloeobacter violaceus genome

  • Homologous expression in cyanobacteria requires specific vectors and promoters, which aren't always compatible across different strains

Membrane Protein Challenges:

  • As a membrane protein component, PetD has hydrophobic regions that can cause folding and solubility issues

  • The protein needs to be extracted from membranes using appropriate detergents that maintain native structure and function

  • Reconstitution into liposomes or nanodiscs may be necessary for functional studies

Complex Assembly Considerations:

  • PetD normally functions as part of a multi-subunit complex, making isolated expression potentially problematic

  • Co-expression with PetB may be necessary as they form a subcomplex that serves as a template for assembly

  • Ensuring proper incorporation of cofactors and post-translational modifications (particularly phosphorylation at T4)

Purification Strategy:

  • Affinity tags must be carefully placed to avoid interfering with function

  • Two-step purification typically required:

    • Initial separation from bulk proteins using affinity chromatography

    • Secondary purification using size exclusion or ion exchange chromatography

Functional Validation Methods:

  • Spectroscopic analysis to verify heme binding and proper folding

  • In vitro electron transport assays to assess functionality

  • Phosphorylation assays to verify interaction with STT7 kinase

These technical challenges require careful optimization of expression constructs, growth conditions, membrane extraction protocols, and purification strategies to obtain properly folded and functional recombinant PetD protein for structural and functional studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.