Recombinant Gloeobacter violaceus Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your requirements for preferential development.
Synonyms
petB; gll1919; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Gloeobacter violaceus (strain PCC 7421)
Target Names
petB
Target Protein Sequence
MSKVYDWFQERLEVQALADDITSKYVPPHVNIFYCLGGVTLICFLVQFATGFAMTYYYKP TVAEAFSSVNYIMDEVSFGWLIRSIHRWSASMMVLAMILHTFRVYLTGGFKRPRELTWVT GVLLACLTVSFGVTGYSLPWDQVGYWAVKIVTQVPSAIPVVGDLIVEFLRGGAGVGQETL TRFYSAHTFVLPWLTVVFMLMHFLMIRKQGISGPL
Uniprot No.

Target Background

Function

Recombinant Gloeobacter violaceus Cytochrome b6 (petB) is a component of the cytochrome b6-f complex. This complex plays a crucial role in mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitating cyclic electron flow around PSI, and regulating state transitions.

Database Links

KEGG: gvi:gvip265

STRING: 251221.gvip265

Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What makes Gloeobacter violaceus cytochrome b6 proteins unique compared to other cyanobacteria?

Gloeobacter violaceus PCC 7421 uniquely encodes two distinct cytochrome b6 proteins (PetB1 and PetB2) in its genome, a characteristic not previously observed in other cyanobacteria, algae, or higher plants. Both proteins are bona fide cytochrome b6 proteins with distinctive spectroscopic characteristics. The key differences include:

  • While PetB1 contains the canonical histidine residue H100 that serves as an axial ligand for heme bH, PetB2 has this histidine residue mutated

  • Despite this mutation, both proteins bind two heme molecules with different midpoint potentials

  • Each petB gene is organized in a separate operon with a petD gene, creating genetic heterogeneity not seen in other photosynthetic organisms

This dual cytochrome b6 system may represent an evolutionary intermediate in photosynthetic electron transport chains, making G. violaceus an important model for studying the evolution of photosynthesis.

What is the phylogenetic significance of Gloeobacter violaceus in cyanobacterial research?

  • Comparative analyses across 14 cyanobacterial genomes place G. violaceus at a divergence point prior to the endosymbiotic event in the cyanobacterial clade

  • It lacks sulfoquinovosyl diacylglycerol and possesses a bacterial-type phytoene desaturase

  • Most distinctively, it lacks thylakoid membranes entirely, with photosynthetic machinery embedded within the plasma membrane instead

These characteristics make G. violaceus an invaluable organism for studying early photosynthetic evolution and the transition to more complex photosynthetic structures. Recent phylogenomic work with another thylakoid-less cyanobacterium (Anthocerobacter) has further reinforced G. violaceus' position as representative of an early-branching cyanobacterial lineage .

What are the optimal expression conditions for producing soluble recombinant Gloeobacter violaceus cytochrome b6 in E. coli?

The expression of cyanobacterial membrane proteins like cytochrome b6 often presents challenges in heterologous systems. Based on recombinant protein expression studies, the following methodological approach is recommended:

  • Vector selection: pET-28a is highly recommended as it has been successfully used for expressing numerous recombinant proteins (>40,000 published articles)

  • Expression optimization using factorial design: Implement a fractional factorial design (2^8-4) to systematically optimize these parameters:

    • Induction temperature (typically lower temperatures of 18-25°C improve solubility)

    • IPTG concentration (0.1-1.0 mM)

    • Post-induction time (4-6 hours optimal, as longer times may reduce productivity)

    • Media composition (supplementation with δ-aminolevulinic acid for heme synthesis)

    • Cell density at induction (OD600 of 0.6-0.8)

  • Construct design improvements: The traditional pET expression vectors have design flaws that can be addressed:

    • Optimize the Shine-Dalgarno sequence distance from the start codon

    • Consider codon optimization for E. coli, particularly for rare codons

    • Remove any potential inhibitory secondary structures in the 5' UTR

The integration of these methodological improvements has been demonstrated to increase soluble protein production by up to 250 mg/L in E. coli expression systems .

What cloning strategies are most effective for expressing the complete Gloeobacter violaceus petB genes in recombinant systems?

Based on successful recombinant protein expression studies, the following methodological approaches are recommended:

  • Signal peptide considerations: For cytochrome b6, determine whether to:

    • Express with the native signal peptide sequence (may aid in membrane localization)

    • Remove the signal peptide coding region (enhances soluble expression)

    • Create both versions to compare expression and functionality

  • Restriction enzyme selection: Employ one of these demonstrated successful strategies:

    • Insert the gene between NdeI and XhoI sites (for N-terminal His-tag fusion)

    • Use NcoI and XhoI sites (for C-terminal His-tag fusion)

    • For difficult cloning, consider BbsI as a 3' restriction endonuclease to yield a four-base overhang compatible with AarI-digested vectors

  • Stop codon handling: For proper expression and tag fusion:

    • Remove the native stop codon (TAA) when fusing to C-terminal tags

    • Verify and correct any premature stop codons through site-directed mutagenesis

    • Consider QuikChange Mutagenesis for efficient correction of sequence issues

A comprehensive cloning strategy is presented in the following table:

Cloning ApproachRestriction SitesExpression OutcomeRecommended Use Case
With signal peptideBamHI/EcoRIComplete protein with membrane associationFunctional studies, membrane integration
Without signal peptideNdeI/XhoIHigher soluble yield, N-terminal His-tagProtein purification, structural studies
TAA-removedNcoI/XhoIC-terminal tagged proteinPurification with C-terminal tags

This systematic approach allows for comparative analysis of different constructs to determine optimal expression conditions for functional studies .

How can researchers distinguish between and characterize the spectroscopic properties of PetB1 and PetB2 from Gloeobacter violaceus?

The spectroscopic characterization of PetB1 and PetB2 requires a methodical approach to detect their subtle differences:

  • Heme binding analysis:

    • Both PetB1 and PetB2 proteins bind heme with high affinity

    • Monitor the Soret band (~400-420 nm) and Q bands (~500-600 nm) in UV-visible absorption spectroscopy

    • PetB1 and PetB2 will show distinctive cytochrome b6 spectroscopic profiles despite PetB2 lacking the canonical H100 residue for heme bH binding

  • Redox potential determination:

    • Employ potentiometric titrations to measure the midpoint potentials of bound hemes

    • Both proteins bind two heme molecules with different midpoint potentials

    • Compare these values with other cytochrome b6 proteins to assess functional differences

  • Mutational analysis approach:

    • Generate a histidine residue at the position corresponding to H100 in PetB2 (as done in previous studies)

    • Characterize changes in spectroscopic properties and heme binding

    • This recreates the canonical heme bH binding cavity and provides insight into the evolutionary divergence of these proteins

This methodological approach enables researchers to establish the functional differences between these two evolutionary distinct cytochrome b6 variants in G. violaceus, providing insight into the evolution of electron transport systems.

What methods are most effective for analyzing the membrane distribution and protein interactions of cytochrome b6 in Gloeobacter violaceus?

Since G. violaceus lacks thylakoid membranes and contains photosynthetic complexes in the plasma membrane, specialized approaches are needed:

  • Membrane fractionation protocol:

    • Use sucrose gradient centrifugation to separate membrane fractions (demonstrated separation at densities of 1.14 g/mL and 1.19 g/mL)

    • The green material (containing most photosynthetic complexes) and orange material represent different domains of the plasma membrane

    • Analyze fractions for petB distribution to determine membrane domain localization

  • Protein interaction analysis:

    • Examine co-distribution patterns with other cytochrome b6f complex components (petA, petC, petD)

    • The table below shows the distribution pattern of cytochrome b6f complex components in membrane fractions of G. violaceus:

ProteinGene IDDistributionRatio (Orange/Green)
petA; cytochrome fglr3039Both0.16
petB; cytochrome b6gll1919Green-
petC; cyt b6f, Rieske subunitglr3038Green-
petD; cyt b6f, subunit 4gll1918Green-
  • Bioenergetic domain identification:

    • Apply fluorescence recovery after photobleaching (FRAP) to assess mobility

    • Use immunogold labeling and electron microscopy to visualize precise membrane localization

    • Analyze the lack of mobility between domains to understand functional organization

This methodological framework reveals that cytochrome b6f components, including petB, are primarily localized to the green fraction of the plasma membrane, suggesting functional bioenergetic domains within the primordial photosynthetic apparatus of G. violaceus.

How does the presence of two petB genes in Gloeobacter violaceus inform our understanding of the evolution of photosynthetic electron transport chains?

The unique presence of two distinct cytochrome b6 proteins (PetB1 and PetB2) in G. violaceus provides a valuable evolutionary perspective:

  • Evolutionary model development:

    • PetB1 contains the canonical heme binding sites, while PetB2 shows mutation at the histidine residue corresponding to H100

    • This suggests a potential gene duplication event followed by functional divergence

    • The organization of each petB gene in a separate operon with a petD gene further supports ancient gene duplication

  • Comparative genomic approach:

    • Examine the conservation of cytochrome b6f complex components across diverse photosynthetic organisms:

ComponentCyanobacteriaChlorobiR. palustrisC. aurantiacusH. mobilis
PetB, PetCPresentPresentPresentPresent-
PetA, PetD, PetG, PetM, PetNPresentPresent---
PetLMissing in G. violaceusPresent---
  • Evolutionary hypothesis testing:

    • The data supports a model where proto-cyanobacteria ("procyanobacteria") conducted anoxygenic photosynthesis

    • The presence of cytochrome b6 in G. violaceus but with distinct characteristics supports its position as an evolutionary intermediate

    • The dual petB system may represent an adaptation during the transition to oxygenic photosynthesis

This methodological approach to evolutionary analysis positions the dual cytochrome b6 system in G. violaceus as a potential "living fossil" that provides insight into the transitions between anoxygenic and oxygenic photosynthesis in early Earth history.

What are the functional implications of the difference in heme binding properties between PetB1 and PetB2 proteins in Gloeobacter violaceus?

The differential heme binding properties between PetB1 and PetB2 have significant functional implications that can be investigated through:

  • Structure-function relationship analysis:

    • Despite PetB2 lacking the canonical H100 histidine residue that serves as an axial ligand for heme bH in PetB1, both proteins bind two heme molecules

    • This suggests alternative structural adaptations for heme coordination in PetB2

    • Site-directed mutagenesis to introduce a histidine at the position corresponding to H100 in PetB2 provides a methodology to test structure-function hypotheses

  • Electron transfer kinetics measurement:

    • The different midpoint potentials of hemes in PetB1 and PetB2 likely affect electron transfer rates

    • Apply laser flash photolysis and stop-flow spectroscopy to measure electron transfer kinetics

    • Compare with the canonical cytochrome b6f complex electron transfer model (modified Q cycle)

  • Physiological role investigation:

    • The two proteins may function in different electron transfer pathways:

      • PetB1 may participate in the standard linear electron transport

      • PetB2 could be involved in alternative electron transport routes, including cyclic electron flow

    • Growth experiments under different light conditions and electron transport measurements can test these hypotheses

This research approach reveals how structural variations in cytochrome b6 proteins contribute to functional diversity in electron transport chains, potentially allowing G. violaceus to adapt to varying environmental conditions through differential electron flow pathways.

What batch correction methods should be applied when analyzing spectroscopic data from different preparations of recombinant Gloeobacter violaceus cytochrome b6?

When working with multiple preparations of recombinant cytochrome b6, batch effects can significantly impact spectroscopic analysis. A methodological approach to address this includes:

  • Batch effect assessment:

    • Apply principal component analysis (PCA) to visualize batch-related variance

    • Use k-nearest neighbor batch effect test (kBET) to quantify batch effects

    • Calculate silhouette scores to measure separation between batches

  • Correction method comparison:

    • Phantom correction: Use a standard reference to normalize across batches

    • ComBat method: Apply parametric empirical Bayes frameworks to adjust for batch effects

    • Limma method: Utilize linear models for batch effect removal

  • Implementation strategy:

    • The effectiveness of these methods can be compared using the following metrics:

Correction MethodkBET Rejection RateSilhouette ScorePCA Batch SeparationRecommended Use Case
UncorrectedHighHighDistinct clustersBaseline comparison
Phantom correctionLowerLowerSimilar to uncorrectedWhen physical standards are available
ComBatLowestLowestMinimal clusteringMultiple batch comparison
LimmaEquivalent to ComBatEquivalent to ComBatMinimal clusteringLarger datasets with covariates

Based on comparable studies, ComBat and Limma methods typically provide superior correction with low batch effects, and there is often no significant difference in the results between these two methods .

These methodological approaches ensure that spectroscopic analyses of recombinant cytochrome b6 preparations yield reliable, reproducible results by minimizing technical variation while preserving biological signal.

How can recombinant Gloeobacter violaceus cytochrome b6 be utilized in synthetic biology applications?

The unique properties of G. violaceus cytochrome b6 proteins offer several opportunities for synthetic biology applications:

  • Minimal photosynthetic system design:

    • G. violaceus represents one of the most reduced sets of photosynthesis components among cyanobacteria

    • The cytochrome b6 proteins can be used to engineer minimalist electron transport chains

    • A methodological approach involves:

      • Identifying essential components through comparative genomic analysis

      • Systematic reconstruction in heterologous hosts

      • Functional testing of electron transport efficiency

  • Redox sensor development:

    • The heme-binding properties of PetB1 and PetB2 can be exploited to develop redox-sensitive biosensors

    • The different midpoint potentials of the bound hemes provide sensitivity across different redox ranges

    • Design approach:

      • Fusion of cytochrome b6 domains with reporter proteins

      • Calibration against known redox standards

      • Validation in different cellular environments

  • Bioenergetic domain engineering:

    • G. violaceus organizes its photosynthetic complexes in bioenergetic domains within the plasma membrane

    • This organizing principle can be applied to:

      • Engineering artificial membranes with defined electron transport domains

      • Creating spatial organization in synthetic cells

      • Improving electron transport efficiency through optimized component arrangement

These methodological approaches leverage the unique evolutionary position and biophysical properties of G. violaceus cytochrome b6 proteins to develop novel biotechnological applications in synthetic biology.

What are the methodological considerations for using cyanobacterial expression systems instead of E. coli for producing functional Gloeobacter violaceus cytochrome b6?

While E. coli is commonly used for recombinant protein expression, cyanobacterial expression systems offer advantages for functional cytochrome b6 production:

  • Host selection criteria:

    • Consider the following model cyanobacterial strains:

      • Synechocystis PCC 6803: First photosynthetic organism with sequenced genome

      • Synechococcus elongatus PCC 7942: Model for circadian studies

      • Synechococcus 7002: Salt and high light tolerant strain

  • Vector system development:

    • Two main approaches can be employed:

      • Replicative vectors: Maintained in the cyanobacterial cell after introduction

      • Integrative vectors: Incorporated into the genome via homologous recombination

    • Note that vectors developed for E. coli often work with reduced efficiency in cyanobacteria

  • Expression optimization strategy:

    • Regulatory elements must be carefully selected:

      • E. coli promoters often function poorly in cyanobacteria

      • Consider native cyanobacterial promoters or synthetic hybrid promoters

    • Tools for regulation include:

      • Anti-sense RNA methods

      • Riboswitch-based regulation

      • CRISPRi for multiplexed gene regulation

  • Functional assessment protocol:

    • Spectroscopic analysis of heme incorporation

    • Membrane integration assessment

    • Electron transport chain functionality testing

This methodological framework provides researchers with alternatives to E. coli expression for producing functional cytochrome b6 in a more native-like photosynthetic context, potentially yielding proteins with improved functionality and proper cofactor incorporation.

What strategies can resolve insolubility issues when expressing recombinant Gloeobacter violaceus cytochrome b6 in E. coli?

Membrane proteins like cytochrome b6 often present solubility challenges during recombinant expression. A systematic troubleshooting approach includes:

  • Construct optimization:

    • Remove the signal peptide sequence (first 23 amino acids for TEM-1)

    • Create fusion constructs with solubility-enhancing tags like SUMO or MBP

    • Test multiple construct versions in parallel:

Construct DesignRestriction SitesPurposeExpected Outcome
Complete sequenceBamHI/EcoRIFull-length proteinLower solubility, potential membrane association
TAA-removedNcoI/XhoIC-terminal tag fusionModerate solubility improvement
Signal peptide removedNdeI/XhoIEnhanced solubilityHighest soluble yield
  • Expression condition optimization:

    • Lower induction temperature (16-20°C)

    • Reduce IPTG concentration (0.1-0.5 mM)

    • Use rich media supplements (terrific broth with additives)

    • Add heme precursors (δ-aminolevulinic acid) to the medium

    • Co-express with chaperones (GroEL/ES, DnaK/J)

  • Solubilization protocol development:

    • For membrane-associated protein:

      • Screen detergents (DDM, LDAO, C12E8)

      • Test solubilization buffers with varying ionic strengths

      • Add glycerol (10-20%) to stabilize protein structure

    • For inclusion bodies:

      • Develop refolding protocols with decreasing denaturant concentrations

      • Include redox pairs (GSH/GSSG) to assist disulfide formation

      • Add heme during refolding to promote proper incorporation

This methodological approach provides researchers with multiple strategies to overcome the common challenge of insolubility when expressing cytochrome b6, a membrane-associated protein with complex cofactor requirements.

How can researchers troubleshoot issues with heme incorporation in recombinant Gloeobacter violaceus cytochrome b6?

Proper heme incorporation is critical for functional cytochrome b6. A systematic troubleshooting methodology includes:

  • Spectroscopic assessment of heme incorporation:

    • Examine the absorption spectrum for characteristic Soret (~400-420 nm) and Q bands (~500-600 nm)

    • Compare with published spectra for native cytochrome b6

    • Reduced incorporation will show decreased absorption intensity at these wavelengths

  • Heme availability optimization:

    • Supplement growth media with:

      • δ-aminolevulinic acid (0.5-1.0 mM) as a heme precursor

      • Iron sources (ferric citrate, 0.1-0.5 mM)

      • Hemin (10-50 μM) for direct incorporation

    • Consider using hemA mutant strains that overproduce heme precursors

  • Co-expression strategies:

    • Co-express with heme maturation factors:

      • CcmABCDEFGH system for cytochrome c-type maturation

      • Although cytochrome b6 does not typically require this system, it may assist with general heme metabolism

    • Use specialized E. coli strains with enhanced heme biosynthesis capacity

  • Post-expression heme reconstitution protocol:

    • For apo-proteins lacking heme:

      • Purify protein under denaturing conditions

      • Add hemin during refolding process

      • Remove excess hemin by gel filtration

      • Verify reconstitution spectroscopically

This methodological approach addresses the critical challenge of ensuring proper cofactor incorporation, which is essential for obtaining functionally active cytochrome b6 for subsequent structural and functional studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.