Recombinant Gloeobacter violaceus Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant G. violaceus plsY (UniProt ID: Q7NMV2) is a full-length enzyme (1–205 amino acids) expressed in E. coli with an N-terminal His-tag for purification. It is lyophilized and stored in a Tris/PBS-based buffer with 6% trehalose (pH 8.0) to maintain stability .

ParameterValue
UniProt IDQ7NMV2
Protein Length205 amino acids
Source OrganismGloeobacter violaceus PCC 7421
Expression SystemE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
Storage Conditions-20°C/-80°C (lyophilized), avoid repeated freeze-thaw cycles

Role in Lipid Biosynthesis

plsY initiates membrane lipid synthesis by acylating G3P to form LPA, which is further acylated by lysophosphatidic acid acyltransferase (LPAAT) to produce phosphatidic acid (PA) . In G. violaceus, this pathway is essential for producing membrane phospholipids, including:

  • Monogalactosyldiacylglycerol (MGDG): Dominant galactolipid in cyanobacterial membranes.

  • Sulfoquinovosyldiacylglycerol (SQDG): Stabilizes photosynthetic complexes .

Evolutionary and Functional Context

  • Primordial Cyanobacteria: G. violaceus lacks thylakoids, necessitating efficient cytoplasmic membrane lipid synthesis. plsY’s activity may compensate for structural limitations in photosynthetic membranes .

  • Fatty Acid Regulation: In other cyanobacteria (e.g., Synechocystis), acyltransferases regulate sn-2 fatty acid positions, influencing membrane fluidity. G. violaceus plsY likely follows analogous regulatory mechanisms .

Experimental Applications

Recombinant plsY is used in:

  • Lipid Metabolic Studies: In vitro assays to study acyltransferase kinetics and substrate specificity.

  • Protein Engineering: His-tagged versions enable purification for structural or enzymatic studies .

Comparative Analysis with Related Enzymes

EnzymeOrganismKey Difference
plsYG. violaceusFull-length, His-tagged, no thylakoid membranes
GPATGeobacter lovleyiShorter length (194 aa), different lipid profiles
LPAATSynechocystisRegulates sn-2 fatty acids, dispensable in mutants

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; gll0663; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Gloeobacter violaceus (strain PCC 7421)
Target Names
plsY
Target Protein Sequence
MNWPLALGIWAASYLAGSLPAGYLAGRRLKNIDIREFGSGSTGATNVLRTLGRGPAAAVL LFDVFKGLFAVWLARTLAGGEDAGAWIVLGAGLAAIVGHSWPVWLAFRGGKSVAVSVGLL LGMHWPVALTVAAVWGVCFAVTRIVSFASIVAAAATPLCFYLWRAPLPFTLFGLLGGIYI VWRHRGNIERLLQGTEPKIGDPAAH
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links

KEGG: gvi:gll0663

STRING: 251221.gll0663

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of Gloeobacter violaceus Glycerol-3-phosphate acyltransferase (plsY)?

Gloeobacter violaceus plsY functions as an acyl-phosphate-dependent glycerol-phosphate acyltransferase that catalyzes the first step in bacterial membrane phospholipid biosynthesis. Unlike the classical PlsB-type acyltransferases that use acyl-CoA or acyl-ACP thioesters, plsY specifically utilizes acyl-phosphate (acyl-PO₄) as the acyl donor to acylate the 1-position of glycerol-phosphate. This reaction sits at the critical interface between the soluble type II fatty acid biosynthetic pathway and membrane phospholipid formation, making it a key regulatory point in bacterial membrane biogenesis .

The enzyme belongs to protein family pfam02660/COG0344 (encompassing the domain of unknown function DUF205) and catalyzes the formation of lysophosphatidic acid, which is subsequently converted to phosphatidic acid - a universal intermediate in bacterial glycerophospholipid biosynthesis .

What are the optimal expression systems for producing recombinant Gloeobacter violaceus plsY?

For successful expression of recombinant Gloeobacter violaceus plsY, researchers should consider several expression systems with specific modifications:

E. coli-based systems:
E. coli has been successfully used to express other Gloeobacter violaceus membrane proteins, notably gloeobacter rhodopsin . For plsY expression, BL21(DE3) or C43(DE3) strains are recommended due to their tolerance for membrane protein overexpression. To enhance expression:

  • Use a low-copy vector with a tunable promoter (like pET with T7lac)

  • Optimize codon usage for E. coli

  • Include an N-terminal fusion tag (His₆ or MBP) for detection and purification

  • Grow cultures at reduced temperatures (18-25°C) after induction to improve folding

  • Supplement with specific phospholipids to stabilize the nascent membrane protein

Yeast expression:
Heterologous expression in Pichia pastoris or Saccharomyces cerevisiae provides a eukaryotic membrane environment that may better accommodate membrane proteins. Evidence from other recombinant Gloeobacter violaceus proteins indicates successful expression in yeast systems .

What purification strategies yield functional recombinant Gloeobacter violaceus plsY?

Purification of membrane-bound acyltransferases requires special considerations to maintain structure and function:

  • Membrane extraction: Use mild detergents such as n-dodecyl-β-D-maltopyranoside (DDM, 0.02-0.05%) for initial solubilization, similar to protocols used for other Gloeobacter violaceus membrane proteins .

  • Affinity chromatography: For His-tagged constructs, use immobilized metal affinity chromatography with Ni-NTA or Co-NTA resins, incorporating low concentrations of detergent in all buffers.

  • Size exclusion chromatography: As a polishing step, separate protein-detergent complexes from aggregates and excess detergent.

  • Buffer optimization: Tris-based buffers with 50% glycerol have been successfully used for Gloeobacter violaceus proteins . This high glycerol concentration helps stabilize membrane proteins during storage.

  • Storage conditions: Store purified protein at -20°C or -80°C, with an expected shelf life of approximately 6 months for liquid formulations and 12 months for lyophilized preparations .

What methods are effective for measuring Gloeobacter violaceus plsY enzymatic activity?

Activity assays for plsY require careful design due to its membrane-bound nature and specific substrate requirements:

Radiometric assay:

  • Prepare radiolabeled substrates (³²P-glycerol-3-phosphate or ¹⁴C-acyl-phosphate)

  • Incubate with purified enzyme in detergent micelles or reconstituted liposomes

  • Extract lipids using chloroform/methanol (2:1 v/v)

  • Separate reaction products via thin-layer chromatography

  • Quantify radiolabeled product formation

Coupled enzymatic assay:

  • Link plsY activity to a secondary reaction that produces a spectrophotometric signal

  • For example, couple phosphate release to a phosphate detection system

  • Monitor reaction progress in real-time through absorbance changes

Mass spectrometry-based assay:

  • Incubate enzyme with unlabeled substrates

  • Quench reactions at defined time points

  • Analyze reaction products using LC-MS/MS

  • Quantify lysophosphatidic acid formation relative to internal standards

When selecting an assay system, researchers should note that bacterial acyltransferases may show different specificities for acyl-CoA versus acyl-ACP substrates. While acyl-CoA substrates are more commercially available and frequently used in assays, the physiological substrate for plsY is acyl-phosphate, which may need to be enzymatically synthesized before use .

How do experimental conditions affect recombinant Gloeobacter violaceus plsY activity?

The enzymatic activity of recombinant Gloeobacter violaceus plsY is significantly influenced by several experimental parameters:

pH optimization:
Membrane-bound acyltransferases typically show a bell-shaped pH dependency curve. For plsY homologs, optimal activity generally occurs between pH 6.5-7.5, reflecting the cytoplasmic pH of the native organism. Testing a range of buffers (PIPES, MOPS, HEPES, Tris) across pH 6.0-8.0 is recommended to determine the precise pH optimum.

Temperature effects:
Although Gloeobacter violaceus is a mesophilic cyanobacterium, its enzymes may show adaptation to variable environmental conditions. Activity assays should be conducted at temperatures ranging from 25-37°C, with special attention to potential cold adaptation properties.

Divalent cation requirements:
Many acyltransferases require Mg²⁺ or Mn²⁺ for optimal activity. Titration experiments with 0-10 mM concentrations of these cations should be performed to establish the specific requirements for Gloeobacter violaceus plsY.

Detergent influence:
The choice and concentration of detergent significantly impact membrane protein activity. Compare multiple detergents (DDM, DM, OG) at concentrations just above their critical micelle concentration to identify optimal conditions for maintaining enzyme activity during assays .

How can mutagenesis approaches reveal structure-function relationships in Gloeobacter violaceus plsY?

Strategic mutagenesis can elucidate critical functional domains and catalytic mechanisms of plsY:

Targeted mutagenesis approach:

  • Conserved residue identification: Perform multiple sequence alignment of plsY homologs to identify highly conserved residues across the PlsY family.

  • Putative catalytic site mutations: Based on predicted catalytic mechanisms for acyl-phosphate-dependent acyltransferases, create alanine substitutions of predicted catalytic residues.

  • Membrane topology validation: Introduce cysteine residues at predicted membrane-interface locations, then perform accessibility studies with membrane-impermeable sulfhydryl reagents.

  • Substrate binding pocket analysis: Create mutations in the predicted acyl chain binding region to alter substrate specificity. This approach successfully revealed carotenoid binding mechanisms in another Gloeobacter violaceus membrane protein (gloeobacter rhodopsin) through a single glycine-to-tryptophan mutation that eliminated specific substrate binding .

  • Testing methodology: Express mutants in parallel using identical conditions, then compare activity levels using standardized assays. For membrane proteins, ensure proper folding and membrane insertion by including controls such as fluorescence-detection size exclusion chromatography.

This systematic mutagenesis strategy has proven effective for other Gloeobacter proteins and acyltransferases from related organisms. For example, studies with Synechocystis acyltransferases demonstrated that deletion mutants (Δ1848, Δ1752, Δ2060) significantly altered fatty acid specificity, suggesting similar approaches would be informative for Gloeobacter plsY .

How does Gloeobacter violaceus plsY contribute to membrane composition regulation?

Acyltransferases like plsY play crucial roles in determining membrane phospholipid composition through substrate selectivity:

Fatty acid selectivity mechanisms:
Gloeobacter violaceus plsY likely exhibits preferences for specific acyl chain lengths and saturation levels. This selectivity creates the initial asymmetry in membrane phospholipid composition. Experimental approaches to characterize this selectivity include:

  • Competitive substrate assays: Offer mixtures of acyl-phosphates with varying chain lengths (C14:0, C16:0, C18:0) and determine incorporation rates.

  • Lipidomic analysis: Compare membrane composition of expression systems before and after plsY overexpression to identify shifts in phospholipid profiles.

Studies in related cyanobacteria (Synechocystis) demonstrate that acyltransferase mutations dramatically alter fatty acid composition, with deletion mutants showing "markedly higher contents of stearate (18:0), oleate (18:1), and linoleate (18:2) in place of palmitate (16:0) in the sn-2 positions" . Similar regulatory functions likely exist for Gloeobacter violaceus plsY.

Regulatory network integration:
PlsY activity coordinates with fatty acid synthesis pathways through:

  • Substrate availability sensing: PlsY activity may be regulated by acyl-phosphate pools, creating feedback to fatty acid synthesis.

  • Co-transcriptional regulation: In many bacteria, plsX (involved in acyl-phosphate production) is often located in gene clusters with fatty acid synthesis enzymes, suggesting coordinated expression .

How can researchers overcome poor expression or solubility of recombinant Gloeobacter violaceus plsY?

Membrane proteins like plsY present significant expression challenges that can be addressed through multiple strategies:

Expression optimization protocols:

  • Fusion partners: N-terminal fusions with MBP, thioredoxin, or SUMO can enhance solubility and expression. Each fusion partner should be tested with appropriate cleavage sites for post-purification removal.

  • Induction conditions: Test various IPTG concentrations (0.1-1.0 mM) and induction temperatures (16-30°C). Lower temperatures and IPTG concentrations often improve membrane protein folding.

  • Media formulation: Supplement with specific phospholipids or glycerol to stabilize membrane proteins during expression. For example, protocols used for gloeobacter rhodopsin expression in E. coli could be adapted for plsY .

  • Specialized expression strains: C41(DE3), C43(DE3), or Lemo21(DE3) E. coli strains are engineered for membrane protein expression and may yield better results than standard BL21(DE3).

Solubilization strategies:

  • Detergent screening: Systematically test multiple detergent classes (maltoside, glucoside, fos-choline) at various concentrations. 0.02% DDM has been effective for other Gloeobacter membrane proteins .

  • Lipid addition: Incorporate specific phospholipids during purification to maintain the native environment. This approach has proven successful for stabilizing acyltransferases from other organisms.

  • Nanodiscs or SMALPs: Consider reconstitution into nanodiscs or extraction using styrene maleic acid copolymers (SMALPs) to maintain a lipid environment without traditional detergents.

What controls should be included when characterizing recombinant Gloeobacter violaceus plsY activity?

Rigorous experimental design requires appropriate controls to validate results:

Essential control experiments:

  • Enzyme-free controls: Measure apparent activity in reaction mixtures lacking the enzyme to account for non-enzymatic acylation or substrate degradation.

  • Heat-inactivated enzyme controls: Compare activity of native enzyme versus heat-denatured samples (95°C for 10 minutes) to distinguish enzymatic activity from potential contaminating enzymes.

  • Substrate specificity validation: Test activity with non-physiological substrates (e.g., glycerol instead of glycerol-3-phosphate) to confirm reaction specificity.

  • Detergent effects baseline: Establish baseline activity measurements with different detergent concentrations, as detergents can influence both substrate accessibility and enzyme conformational stability.

  • Activity versus protein concentration: Verify linearity between enzyme concentration and activity to ensure measurements are made in the appropriate range.

Using established LPAAT activity measurement protocols adapted from other bacterial systems provides a solid foundation. For example, methods used for measuring acyltransferase activity in Synechocystis sp. PCC6803 could be adapted, where "LPAAT activity toward 16:0 CoA decreased markedly in Δ1848 and Δ1848 Δ2060" mutants .

How does Gloeobacter violaceus plsY compare to acyltransferases from other cyanobacteria and bacteria?

Comparative analysis reveals important evolutionary and functional relationships:

Phylogenetic classification:
Gloeobacter violaceus plsY belongs to the widespread PlsY family (pfam02660/COG0344) found across diverse bacterial phyla. Unlike the PlsB-type acyltransferases in E. coli and other gamma-proteobacteria, the PlsY system represents the most widely distributed bacterial glycerol-phosphate acyltransferase system .

Gloeobacter violaceus is particularly interesting as an early-branching cyanobacterium, providing insights into ancient photosynthetic pathways. Its plsY likely represents an ancestral form of the enzyme, making it valuable for evolutionary studies of membrane biogenesis.

Functional differences:

  • Substrate utilization: Unlike dual-specificity acyltransferases from E. coli that can use both acyl-CoA and acyl-ACP, cyanobacterial acyltransferases may show stricter substrate preferences, similar to observed patterns in Gram-positive bacteria where "PlsC proteins from Streptococcus pneumoniae and B. subtilis do not accept acyl-CoA as an acyl donor" .

  • Fatty acid selection: Cyanobacterial acyltransferases show distinctive patterns of fatty acid incorporation. Studies in Synechocystis sp. PCC6803 revealed that "most extant cyanobacteria contain C16 fatty acids in the sn-2 positions of glycerolipids" . Investigating whether Gloeobacter violaceus plsY follows similar patterns would provide valuable comparative data.

  • Regulatory networks: The gene context of plsY varies across bacterial phyla, suggesting different regulatory networks. In many bacteria, plsX is associated with fatty acid synthesis genes, while this arrangement may differ in Gloeobacter, potentially reflecting unique regulatory mechanisms .

What adaptive significance might Gloeobacter violaceus plsY have for this unique cyanobacterium?

Gloeobacter violaceus occupies a special position in cyanobacterial evolution, lacking thylakoid membranes and possessing other primitive characteristics. Its acyltransferases may reflect adaptations to its unique cellular architecture:

Membrane architecture adaptations:
Gloeobacter violaceus conducts photosynthesis in the cytoplasmic membrane rather than specialized thylakoid membranes. This unique arrangement may place special requirements on membrane composition and fluidity, potentially reflected in plsY substrate specificity and activity. The enzyme might be optimized for creating membranes that accommodate both respiratory and photosynthetic complexes in a single membrane system.

Environmental adaptations:
Gloeobacter species typically inhabit limestone rocks and calcareous surfaces, environments with distinctive temperature and light characteristics. The plsY enzyme may show adaptations to these conditions, potentially including:

  • Temperature optima reflecting the moderate temperatures of its native habitat

  • Substrate preferences that produce membranes with appropriate fluidity for these environments

  • Regulatory mechanisms coordinated with light-dependent processes

Integration with unique metabolic features:
Gloeobacter violaceus contains unusual carotenoids including echinenone, which has a 4-keto-ring similar to salinixanthin . Research on gloeobacter rhodopsin demonstrated that this protein can bind carotenoids as light-harvesting antennae . Similarly, plsY may have evolved to create membrane environments that accommodate these specialized photosynthetic components.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.