Recombinant Gloeobacter violaceus NAD (P)H-quinone oxidoreductase subunit 3 (ndhC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ndhC; glr0748; NAD(PH-quinone oxidoreductase subunit 3; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3; NDH-1 subunit 3; NDH-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Gloeobacter violaceus (strain PCC 7421)
Target Names
ndhC
Target Protein Sequence
MFVLSGYDALLIFLLLSALVPVLALTISYLIRPKGSGAFRTTTYESGVDPRGDSWIQFNI RYYMFALVFVVFDVETVFLYPWAVAFNQLGLLAFIEALIFIAILVVALVYAWRKGALEWT
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from an unidentified electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory and/or photosynthetic chain. In this organism, plastoquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, conserving redox energy as a proton gradient. In cyanobacteria, NDH-1 also contributes to inorganic carbon concentration.

Database Links

KEGG: gvi:gvip080

STRING: 251221.gvip080

Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does ndhC function within cyanobacterial electron transport systems?

The ndhC subunit functions as an integral component of the NAD(P)H:quinone oxidoreductase complex in cyanobacterial electron transport systems. Based on studies of related systems, ndhC likely participates in the transfer of electrons from NAD(P)H to quinones, contributing to the generation of a proton gradient for ATP synthesis. While specific functions of Gloeobacter violaceus ndhC have not been directly examined in the provided search results, research on related NAD(P)H:quinone oxidoreductases in Synechocystis sp. PCC 6803 demonstrates their important role in quinone reduction .

NAD(P)H:quinone oxidoreductase (NQR) activities in cyanobacteria have been shown to be crucial for protecting cells against quinone-type inhibitors through reduction of exogenous quinones to less toxic hydroquinones . More than 60% of NADPH:quinone-reductase activity in photoautotrophically grown cyanobacterial cells is attributed to NQR function, suggesting the significant role of these enzymes in redox homeostasis . Additionally, they may participate in the reduction of the Photosystem I reaction center (P700+) after photooxidation, influencing photosynthetic electron flow, as demonstrated in wild-type versus NQR-deficient mutant cells of Synechocystis .

What structural features characterize the ndhC protein?

The ndhC protein exhibits several characteristic structural features that influence its function and localization in the cell. Based on the amino acid sequence, ndhC is a hydrophobic protein with multiple transmembrane domains, consistent with its role in membrane-associated electron transport processes . The protein contains regions that anchor it within the membrane, allowing it to participate in electron transfer across membrane compartments.

For recombinant expression studies, it's notable that the full-length protein can be produced and maintained in a Tris-based buffer with 50% glycerol for stability . The storage recommendations (maintaining at -20°C for regular storage or -20°C to -80°C for extended storage) suggest structural elements that can be destabilized by repeated freeze-thaw cycles .

While the search results don't provide specific X-ray crystallography or NMR data for Gloeobacter violaceus ndhC, the related NAD(P)H:quinone oxidoreductases in other organisms contain various redox-active cofactors, including flavin mononucleotide (FMN), iron-sulfur clusters, or other metal centers. For example, in the Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) complex from Vibrio species, specific subunits contain covalently attached FMN, a 2Fe-2S cluster, riboflavin, and ubiquinone-8 . The ndhC subunit may contribute to binding sites for similar cofactors or participate in forming electron transfer pathways within the larger complex.

What are the genetic characteristics of the ndhC gene in Gloeobacter violaceus?

The ndhC gene in Gloeobacter violaceus is identified by the ordered locus name glr0748 in the genome . This gene encodes the NDH-C subunit of the NAD(P)H:quinone oxidoreductase complex. While detailed genetic analysis of the Gloeobacter violaceus ndhC gene is not provided in the search results, information about homologous genes in related systems can offer insights.

In cyanobacteria, genes encoding components of electron transport chains often show conservation across species with adaptations reflecting the specific ecological niches occupied by different organisms. Gloeobacter violaceus represents an early-branching cyanobacterial lineage that lacks thylakoid membranes, making its electron transport components particularly interesting from an evolutionary perspective.

The expression region of the ndhC protein is reported as 1-120, suggesting this portion of the gene is specifically important for the protein's functional expression . In related systems, the regulation of genes encoding NAD(P)H:quinone oxidoreductase subunits can be influenced by environmental conditions, including light intensity, nutrient availability, and oxidative stress, reflecting their roles in energy metabolism and redox homeostasis.

What experimental approaches are optimal for studying ndhC function in cyanobacteria?

Multiple experimental approaches can be employed to study ndhC function in cyanobacteria, each offering distinct advantages for examining different aspects of the protein's biochemistry and physiology.

Genetic manipulation techniques:

  • Gene knockout or disruption studies can reveal the phenotypic consequences of ndhC absence. Similar approaches with the drgA gene encoding NAD(P)H:quinone oxidoreductase in Synechocystis sp. PCC 6803 demonstrated increased sensitivity to quinone-type inhibitors in mutant strains (Ins2) compared to wild type .

  • Site-directed mutagenesis of conserved residues can identify amino acids critical for function. Research on related NAD(P)H:quinone oxidoreductases has employed this approach to examine the role of conserved cysteine residues in subunits NqrD and NqrE, revealing their importance for correct folding and stability of the complex .

Biochemical assays:

  • Enzyme activity assays measuring NADPH:quinone-reductase activity in soluble and membrane fractions, as performed with Synechocystis NQR, can determine the localization and relative contribution of ndhC to total cellular reductase activity .

  • EPR spectroscopy can be used to study electron transfer rates and the involvement of the protein in specific redox processes. For example, EPR has been used to examine the effects of menadione and menadiol on the reduction of Photosystem I reaction center (P700+) after photooxidation in wild-type versus NQR-deficient cyanobacteria .

Structural biology approaches:

  • Membrane topology mapping using PhoA-Green Fluorescent Protein fusion analysis, as applied to Na+-NQR subunits from Vibrio cholerae, can determine the arrangement of transmembrane segments and the orientation of domains relative to the membrane .

  • Mass spectroscopy and other analytical techniques can identify post-translational modifications, cofactor binding, and protein-protein interactions within the larger complex.

How does recombinant ndhC protein compare to native protein in functional assays?

The comparison between recombinant and native ndhC protein in functional assays involves several considerations that affect experimental design and interpretation. While direct comparative data for Gloeobacter violaceus ndhC is not provided in the search results, insights can be derived from studies of related proteins.

Expression system effects:
Heterologous expression of membrane proteins like ndhC may result in differences from the native protein due to:

  • Lack of native post-translational modifications or improper folding in the expression host

  • Absence of natural binding partners or assembly factors

  • Different lipid environments affecting protein conformation and activity

For instance, research on the Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) from Vibrio harveyi demonstrated that expression of the nqr operon alone in Escherichia coli resulted in an enzyme incapable of Na+-dependent NADH oxidation, whereas co-expression with maturation factors (apbE and nqrM genes) was necessary to produce functional protein . This suggests that proper assembly and activity of complex oxidoreductases often require specific maturation factors that may not be present in heterologous expression systems.

Functional evaluation approaches:
When evaluating recombinant ndhC:

  • Enzymatic assays comparing specific activity, substrate affinity, and inhibitor sensitivity between recombinant and native forms

  • Spectroscopic analyses to verify proper cofactor incorporation and redox properties

  • Reconstitution experiments combining purified recombinant ndhC with other subunits to assess complex formation and function

The recombinant Gloeobacter violaceus ndhC available for research is provided with specific storage recommendations (store at -20°C, avoid repeated freeze-thaw cycles, keep working aliquots at 4°C for up to one week), suggesting conditions necessary to maintain protein stability and functionality .

What methods can be used to study the membrane topology of ndhC?

Understanding the membrane topology of ndhC is essential for elucidating its function in electron transfer processes. Several complementary methods can be employed to determine how this protein is oriented within the membrane:

2. Fusion protein approaches:
Reporter fusion techniques offer experimental validation of topology predictions:

  • PhoA (alkaline phosphatase) fusions: Active when located in the periplasm

  • GFP (green fluorescent protein) fusions: Fluorescent when located in the cytoplasm

By creating a series of C-terminal fusions with these reporters at different points in the ndhC sequence, researchers can map which regions face the cytoplasmic versus periplasmic/lumenal side of the membrane .

3. Protease accessibility assays:
Limited proteolysis of membrane preparations followed by mass spectrometry identification of cleavage sites can identify exposed regions of the protein.

4. Chemical labeling techniques:
Site-specific chemical modification using membrane-permeable versus impermeable reagents can distinguish between cytoplasmic and periplasmic/lumenal domains.

5. Cryo-electron microscopy:
For structural determination of the entire NAD(P)H:quinone oxidoreductase complex, including the position and orientation of ndhC within the larger assembly.

A comprehensive topology analysis would likely combine several of these approaches to develop a consensus model, as each method has inherent limitations and potential artifacts.

How can site-directed mutagenesis be used to investigate structure-function relationships in ndhC?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in ndhC. By systematically altering specific amino acid residues and assessing the impact on protein activity, stability, and interactions, researchers can identify critical functional domains and mechanistic details.

Table 1: Potential Target Residues for Site-Directed Mutagenesis in ndhC

CategoryTarget ResiduesRationaleExpected Impact
Conserved cysteinesCys residues in transmembrane domainsMay form binding sites for cofactors or participate in redox reactionsAltered electron transfer capacity, similar to effects seen in NqrD/E cysteine mutants
Acidic residuesAsp/Glu in transmembrane regionsPotential involvement in cation binding or translocationChanges in ion specificity or coupling efficiency, as observed in Na+-NQR
Aromatic residuesTyr/Trp/Phe in predicted quinone binding regionsMay participate in pi-stacking interactions with quinone ringsReduced substrate binding affinity or altered specificity
Predicted cofactor binding sitesResidues identified through homology modelingEssential for proper cofactor coordinationLoss of cofactor binding and associated electron transfer activity
Inter-subunit interaction sitesSurface-exposed residues at predicted protein-protein interfacesMediate assembly with other complex componentsDisrupted complex formation while potentially maintaining intrinsic activity

Experimental approaches for evaluating mutagenesis effects:

  • Biochemical characterization:

    • Measurement of electron transfer rates with various substrates

    • Determination of kinetic parameters (Km, Vmax) for mutant versus wild-type proteins

    • Assessment of inhibitor sensitivity profiles

  • Biophysical analyses:

    • Thermal stability assays to detect structural perturbations

    • Spectroscopic techniques (UV-vis, EPR, fluorescence) to monitor cofactor binding and redox status

    • Protein crystallography or cryo-EM for structural determination of mutant proteins

Studies on related enzymes provide instructive examples of this approach. In Na+-NQR research, mutation of conserved cysteine residues in NqrD and NqrE subunits "blocked the Na+-dependent and 2-n-heptyl-4-hydroxyquinoline N-oxide-sensitive quinone reductase activity of the enzyme," while not affecting "the interaction of NQR with NADH and menadione" . Similarly, mutations in acidic residues of NqrB, NqrD, and NqrE revealed their roles in sodium translocation, with changes at NqrB-D397, NqrD-D133, and NqrE-E95 producing "a decrease of approximately ten times or more in the apparent affinity of the enzyme for sodium" .

What is known about the redox properties and electron transfer mechanisms of ndhC?

The redox properties and electron transfer mechanisms of NAD(P)H:quinone oxidoreductases are central to their biological function. While specific data for Gloeobacter violaceus ndhC is limited in the search results, information from related systems provides insights into potential mechanisms.

NAD(P)H:quinone oxidoreductases catalyze the transfer of electrons from NAD(P)H to quinones, with the sequence of electron flow typically proceeding through multiple redox cofactors within the protein complex. These cofactors can include FAD, FMN, iron-sulfur clusters, and other metal centers that form an electron transfer chain with appropriate redox potentials to facilitate directional electron movement.

In studies of the cyanobacterium Synechocystis sp. PCC 6803, NAD(P)H:quinone oxidoreductase (NQR) encoded by the drgA gene demonstrated NADPH:quinone-reductase activity primarily in the soluble fraction of cells rather than the membrane fraction . This localization pattern differs from the membrane-bound Na+-NQR found in Vibrio species, suggesting potential differences in electron transfer pathways despite functional similarities.

The redox cofactors involved in electron transfer can be identified through spectroscopic methods. For example, in Vibrio harveyi Na+-NQR, "Mass and EPR spectroscopy showed that NQR from V. harveyi bears only a 2Fe-2S cluster as a metal-containing prosthetic group" . Additionally, the complex contained FMN residues covalently attached to certain subunits, with the flavin transferase encoded by the apbE gene catalyzing this attachment .

EPR spectroscopy has proven particularly valuable for studying electron transfer kinetics in these systems. In Synechocystis, EPR was used to examine "the effects of menadione and menadiol on the reduction of Photosystem I reaction center (P700+) after its photooxidation in the presence of DCMU" . The results showed that "addition of menadione increased the rate of P700+ reduction in WT cells, whereas in Ins2 mutant [lacking NQR] the reduction of P700+ was strongly inhibited" . These findings suggest that NAD(P)H:quinone oxidoreductases can influence electron flow to photosystems by reducing quinones to hydroquinones.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.