Recombinant Gloeobacter violaceus Photosystem I reaction center subunit III (psaF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
psaF; glr2732; Photosystem I reaction center subunit III; PSI-F
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
31-181
Protein Length
full length protein
Species
Gloeobacter violaceus (strain PCC 7421)
Target Names
psaF
Target Protein Sequence
QTQVKDPLKLCKDVPAYQELKTQRLEAAQKAQADGKPVTFNEAGTKQKFERYDTAYCGQD GYPHLITSGQLDRAGDFLIPSVLFLWIAGALGWAGRLYLAESKGPEDEIIIDLPKAIKCL LLGLIWPVQAIPELISGKIRVPEDRVTISPR
Uniprot No.

Target Background

Function
This protein likely participates in the efficient electron transfer from plastocyanin to P700 (or cytochrome c553 in algae and cyanobacteria). Its function as a plastocyanin-docking protein facilitates the specific interaction between plastocyanin and Photosystem I (PSI).
Database Links

KEGG: gvi:gvip379

STRING: 251221.gvip379

Protein Families
PsaF family
Subcellular Location
Cell inner membrane. Note=The soluble domain is associated with the lumenal side of the cytoplasmic membrane.

Q&A

What is Gloeobacter violaceus and why is it significant for photosynthesis research?

Gloeobacter violaceus PCC 7421 is a unique cyanobacterium that lacks thylakoid membranes, with photosynthesis occurring directly in the cytoplasmic membranes similar to anoxygenic photosynthetic bacteria. Molecular phylogenetic analyses based on 16S ribosomal RNA place Gloeobacter at the earliest branch of the cyanobacterial evolutionary tree, indicating its primordial nature .

Research significance:

  • Serves as a model organism for studying early evolution of oxygenic photosynthesis

  • Provides insights into minimal requirements for photosynthetic machinery

  • Exhibits unique genomic features, including a psbADC operon not observed in other oxygenic phototrophs

  • Represents a transitional photosynthetic system between anoxygenic bacteria and typical cyanobacteria

Methodological approach for evolutionary studies:

  • Construct phylogenetic trees using 16S rRNA sequences with Gloeobacter as an outgroup

  • Compare genomic organization of photosynthetic genes across cyanobacterial species

  • Analyze protein sequence conservation patterns between Gloeobacter and other phototrophs

  • Examine structural adaptations that compensate for the absence of thylakoid membranes

What structural and functional characteristics distinguish PsaF in Gloeobacter violaceus from other cyanobacteria?

Gloeobacter violaceus PsaF displays several distinctive structural features compared to its counterparts in other cyanobacteria:

FeatureGloeobacter violaceus PsaFOther Cyanobacterial PsaF
Loop structuresContains unique Loop4 (Gln31–Asp36)Lacks the Gln31–Asp36 loop motif
LocationPeriplasmic side of PSI monomerSimilar periplasmic orientation
Interaction with chlorophyllsLacks Chl1F binding capacityContains coordinated Chl1F
Evolutionary statusPrimordial formMore derived form

Methodological approaches to characterize these differences:

  • Perform site-directed mutagenesis targeting the Loop4 region to assess functional significance

  • Use cryo-electron microscopy at high resolution (≤2.5Å) to resolve structural details

  • Conduct comparative spectroscopic analyses to determine how structural differences affect energy transfer

  • Employ recombinant expression systems to isolate and study the properties of PsaF independently

The unique Loop4 structure appears at the periplasmic side of the PSI monomer, suggesting potential adaptation to the absence of thylakoid membranes. This structural distinction likely affects interactions with electron donors and may represent an ancestral form of the protein that predates specialized thylakoid membrane organization .

How does the absence of certain chlorophylls in Gloeobacter violaceus PSI affect its spectroscopic properties?

Unlike other cyanobacteria, Gloeobacter violaceus PSI does not exhibit characteristic fluorescence peaks at around 723 or 730 nm in both in vivo and in vitro fluorescence-emission spectra . This spectroscopic difference correlates with structural analysis showing the absence of specific chlorophyll molecules:

ChlorophyllStatus in Gloeobacter PSIFunction in Other CyanobacteriaSpectroscopic Impact
Chl1FAbsentEnergy transferElimination of ~730 nm fluorescence
Chl1AAbsent due to Phe243 substitutionRed-shifted absorptionAbsence of ~723 nm emission
Chl1J/Chl2JAbsent (lack of PsaK)Red-shifted emissionModified excitation energy transfer

Methodological approaches to investigate spectroscopic consequences:

  • Perform temperature-dependent (77K) fluorescence spectroscopy to resolve emission bands

  • Utilize time-resolved spectroscopy to track energy transfer pathways

  • Conduct site-directed mutagenesis to introduce binding sites for missing chlorophylls

  • Compare absorption difference spectra of P740 (Gloeobacter primary donor) with P700 (typical cyanobacterial primary donor)

The absence of these chlorophylls represents a simpler, potentially more ancient arrangement of the light-harvesting apparatus, providing important insights into the evolution of energy transfer pathways in oxygenic photosynthesis. The high-resolution structure at 2.04 Å confirms that specific structural features prevent the binding of these chlorophylls in Gloeobacter .

What methodologies are most effective for expressing and purifying recombinant Gloeobacter violaceus PsaF for structural studies?

Based on successful approaches with related photosynthetic proteins, the following methodological framework is recommended:

Expression System Selection and Optimization:

Expression SystemAdvantagesDisadvantagesYield Optimization
E. coli pET systemHigh expression levels, simple geneticsLacks post-translational modificationsCo-expression with chaperones; low temperature induction (15-18°C)
Cyanobacterial hostsNative folding environmentLower yields, genetic manipulation challengesUse strong, inducible promoters; optimize light/dark cycles
Cell-free systemsAvoids toxicity issues, rapidExpensive, limited scaleSupplement with membrane mimetics for proper folding

Purification Strategy:

  • Initial extraction with mild detergents (β-DDM at 1%) to maintain structural integrity

  • Metal affinity chromatography using N-terminal His-tag (avoid C-terminal tags that may interfere with membrane association)

  • Ion-exchange chromatography with Q-Sepharose at pH 6.5 with increasing NaCl gradient (200-300 mM)

  • Size exclusion chromatography in buffer containing 0.2 M trehalose, 20 mM MES-NaOH (pH 6.5), 5 mM CaCl₂, and 10 mM MgCl₂

  • Validation of functional integrity through spectroscopic analysis of P740 formation

Protein Quality Assessment:

  • Circular dichroism to confirm secondary structure

  • Thermal stability assessment using differential scanning calorimetry

  • Functional validation through reconstitution experiments with electron donors/acceptors

  • Limited proteolysis to identify stable domains

For optimal results, expression should be conducted at reduced temperatures (20°C) with media supplemented with KW21 to enhance growth of photosynthetic organisms. The cytoplasmic membrane fraction should be carefully isolated and solubilized with β-DDM at a chlorophyll concentration of approximately 0.5 mg/ml .

How does PsaF function as a regulatory checkpoint in photosystem assembly and electron transfer?

Recent structural studies have revealed that PsaF serves as a critical regulatory checkpoint that promotes the assembly of Light-Harvesting Complex I (LHCI), effectively coupling biogenesis to function . This regulatory role has significant implications for understanding both the assembly process and electron transfer dynamics of PSI.

PsaF-Mediated Assembly Regulation:

Assembly StagePsaF RoleExperimental Evidence
Pre-PSI-1Absent or incorrectly positionedNo electron transfer activity between Pc and P700
Mature PSICorrectly integratedNormal electron transfer from Pc to P700 with characteristic kinetics
Salt-treated PSIWeakened ionic interactionsSlowed electron transfer, allowing P700 oxidation to accumulate

Methodological Approaches to Study Assembly Checkpoint Function:

  • Pulse-chase experiments with radiolabeled amino acids to track assembly intermediates

  • Time-resolved spectroscopy to measure electron transfer rates as function of assembly stage

  • Site-directed mutagenesis of key residues in PsaF to identify critical interaction points

  • Reconstitution experiments with isolated Photosystem I lacking PsaF

Light-induced P700 photo-oxidation assays provide crucial insights into PsaF function. When P700 oxidation and reduction by plastocyanin (Pc) are monitored at different Pc concentrations:

  • Mature PSI shows fully oxidized P700 upon illumination that is re-reduced in the dark

  • Pre-PSI-1 shows markedly slowed electron transfer, enabling accumulation of oxidized P700 regardless of Pc concentration

  • Addition of NaCl weakens ionic interactions between Pc and PsaF, resulting in light-dependent accumulation of oxidized P700

These findings suggest that proper positioning of PsaF is essential for efficient electron transfer and that it serves as a functional gatekeeper that ensures only properly assembled complexes participate in electron transport.

What experimental approaches can resolve contradictory data regarding electron transfer rates in Gloeobacter violaceus PSI?

Research on electron transfer in Gloeobacter violaceus PSI has produced seemingly contradictory results regarding rates and efficiencies. These contradictions can be systematically addressed through the following methodological framework:

Standardization of Experimental Conditions:

VariableControl MethodsImpact on Measurements
Sample preparationStandardize detergent concentration and purification protocolAffects structural integrity and native interactions
Electron donors/acceptorsUse defined concentrations of plastocyanin/cytochrome c6Influences measured kinetics
Measuring equipmentCalibrate using standard redox mediatorsEnsures comparability between laboratories
TemperatureControl at physiologically relevant points (15-25°C)Affects reaction rates exponentially

Comprehensive Kinetic Analysis Approach:

  • Utilize multiple spectroscopic techniques in parallel:

    • Absorption transients at multiple wavelengths (740 nm, 710 nm, 690 nm)

    • EPR spectroscopy to directly measure P740+ formation

    • Time-resolved fluorescence to track energy transfer preceding charge separation

  • Employ various electron acceptors to probe different aspects of electron transfer:

    • Methyl viologen (E₀' = -446 mV) to study forward electron transfer

    • Dithionite to investigate charge recombination pathways

    • Safranin (E₀' = -290 mV) to monitor reduction and reoxidation kinetics

  • Systematically vary conditions to identify sources of variability:

    • Range of salt concentrations to modulate electrostatic interactions

    • pH variations to probe proton-coupled electron transfer

    • Light intensity dependence to distinguish rate-limiting steps

Data Integration Framework:

Experimental evidence indicates that in the P740-type reaction center of Gloeobacter:

  • Addition of methyl viologen or Safranin oxidizes photo-reduced FA/FB iron-sulfur centers

  • Dithionite pre-reduction accelerates P740+ decay to approximately 1.4 ms

  • Safranin (40 μM) shows reduction and reoxidation after excitation with time constants of 1.8 ms and 26 ms, respectively

These findings suggest that the electron transfer pathway in Gloeobacter PSI involves similar cofactors (FX, FA, FB iron-sulfur centers) as found in P700-type PSI reaction centers, despite the structural differences. By systematically comparing reaction kinetics under identical conditions, apparent contradictions can be resolved and a unified model of electron transfer in this primordial system can be developed.

How does the evolutionary position of Gloeobacter violaceus inform our understanding of photosystem subunit co-evolution?

Gloeobacter violaceus represents a critical reference point for understanding the evolutionary trajectory of photosynthetic machinery, particularly regarding the co-evolution of PSI subunits.

Phylogenetic Analysis Framework:

Evolutionary FeatureEvidence in GloeobacterImplications for Photosystem Evolution
Gene organizationpsbADC operon structure not found in other cyanobacteriaSuggests ancestral gene clustering that was later separated
PsaF structural featuresUnique Loop4 structureRepresents an evolutionary intermediate form
Chlorophyll organizationAbsence of red-shifted chlorophyllsIndicates later addition of specialized energy transfer pathways
Membrane architectureLack of thylakoid membranesSuggests specialized membranes evolved after core photosystems

Methodological Approaches for Evolutionary Analysis:

  • Construct maximum likelihood phylogenetic trees using conserved domains of PSI subunits

  • Perform synteny analysis of photosynthetic gene clusters across cyanobacterial genomes

  • Apply molecular clock analyses calibrated with fossil evidence to date divergence events

  • Use ancestral sequence reconstruction to infer properties of proto-photosystems

Gloeobacter's position as the earliest diverging oxyphotobacterium on the 16S rRNA tree provides a unique window into early photosystem evolution . The existence of a psbADC operon in Gloeobacter, encoding three of the five reaction center core subunits (D1, D2, and CP43), represents the first documented example of a transcribed gene cluster containing D1/D2 or D1/D2/CP43 subunits in any oxygenic phototroph .

This ancestral genomic arrangement suggests that the progenitor of all extant cyanobacteria likely featured clustered photosynthetic genes that were subsequently separated in later-diverging lineages. The separation may have enhanced repair efficiency of the frequently damaged D1 protein, as contemporary Gloeobacter maintains the psbADC operon structure but has four other copies of psbA elsewhere in the genome to allow independent expression .

What approaches can resolve the structural basis for the absence of low-energy chlorophylls in Gloeobacter violaceus PSI?

The absence of low-energy (red) chlorophylls in Gloeobacter violaceus PSI presents a fascinating structural problem with significant implications for understanding energy transfer in photosystems.

Structural Determinants of Chlorophyll Binding:

Missing ChlorophyllStructural Reason for AbsenceMethodological Approach
Chl1FMap quality indicates complete absenceTargeted mutagenesis to introduce binding site
Chl1AHis→Phe243 substitution causing steric hindranceSite-directed mutagenesis of Phe243 to His
Chl1J/Chl2JAbsence of PsaK in genome and structureHeterologous expression of PsaK with Gloeobacter PSI

Comprehensive Structural Analysis Strategy:

  • Perform high-resolution structural studies:

    • Cryo-EM analysis at resolutions better than 2.0 Å (the current structure is at 2.04 Å)

    • X-ray crystallography of PSI complexes to resolve subtle structural features

    • Solid-state NMR to examine chlorophyll-protein interactions

  • Conduct structure-guided mutagenesis:

    • Introduce amino acids that could coordinate missing chlorophylls

    • Engineer binding pockets based on structures from other cyanobacteria

    • Create chimeric proteins with domains from chlorophyll-binding regions of other species

  • Employ spectroscopic validation:

    • 77K fluorescence spectroscopy to detect emergence of far-red emission

    • Circular dichroism to monitor changes in pigment-protein interactions

    • Transient absorption spectroscopy to examine altered energy transfer pathways

The high-resolution structure of Gloeobacter PSI reveals that Loop1 (Tyr515–Gln529) and Loop2 (Asn652–Ser665) in PsaA, Loop3 (Pro717–Ile727) in PsaB, and Loop4 (Gln31–Asp36) in PsaF create a structural environment incompatible with binding the chlorophylls that typically give rise to red-shifted absorption in other cyanobacteria .

The change of the conserved His residue to Phe243 in Gloeobacter PSI is particularly significant, as it creates a steric hindrance that prevents Chl1A binding . This substitution could serve as a target for mutagenesis experiments to reintroduce the chlorophyll binding capacity and potentially create red-shifted absorption in the engineered complex.

What are the implications of Gloeobacter violaceus PSI research for understanding the minimum requirements of oxygenic photosynthesis?

Research on Gloeobacter violaceus PSI provides critical insights into the fundamental requirements for oxygenic photosynthesis, challenging several assumptions about photosystem structure and function.

Key Implications for Photosynthesis Understanding:

  • Structural Minimalism: Gloeobacter PSI functions effectively despite lacking several subunits and chlorophylls found in other cyanobacteria, suggesting these components represent later evolutionary refinements rather than core requirements.

  • Membrane Architecture: The absence of thylakoid membranes demonstrates that specialized membrane compartmentalization is not essential for oxygenic photosynthesis, though it may enhance efficiency.

  • Evolutionary Trajectory: The presence of the psbADC operon supports models where gene clustering preceded the specialized repair mechanisms seen in modern cyanobacteria.

  • Energy Transfer Optimization: The absence of red chlorophylls indicates that the earliest photosystems may have operated with simpler excitation energy pathways before evolving specialized low-energy traps.

  • Assembly Regulation: The role of PsaF as a regulatory checkpoint suggests that coupling assembly to function is a fundamental feature preserved throughout evolution.

Comparative analysis of Gloeobacter violaceus PSI reaction center with other systems offers a window into the transition from anoxygenic to oxygenic photosynthesis. The primary donor P740 in Gloeobacter (compared to P700 in typical cyanobacteria) suggests adaptation to different evolutionary pressures .

The extinction coefficient of P740 at 740 nm (90 mM⁻¹cm⁻¹) is approximately 1.4 times larger than that of P700 at 700 nm (64 mM⁻¹cm⁻¹), indicating significant differences in electronic structure . These spectroscopic differences, combined with the structural simplicity of Gloeobacter PSI, provide a foundation for reconstructing the evolutionary trajectory of photosynthetic reaction centers.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.