Recombinant Gloeobacter violaceus Photosystem Q (B) protein 2 (psbA2)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Gloeobacter violaceus Photosystem Q(B) protein 2 (psbA2) is a 344-amino-acid protein encoded by the psbA2 gene (glr1706 locus) in Gloeobacter violaceus PCC 7421. Produced in E. coli with an N-terminal His tag, this recombinant protein is purified to >90% homogeneity via SDS-PAGE . Key specifications include:

PropertyDetails
UniProt IDQ7NJX5
Expression SystemEscherichia coli
Protein LengthFull-length (1-344 aa)
TagN-terminal His tag
FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Storage-20°C/-80°C; reconstitution in deionized water (0.1–1.0 mg/mL) with glycerol

The amino acid sequence features conserved residues critical for Photosystem II (PSII) function, including ligand-binding sites for cofactors involved in electron transport .

Functional Role in Photosynthesis

PsbA2 is a D1 reaction center protein integral to PSII, facilitating water oxidation and plastoquinone binding . Unlike most cyanobacteria, Gloeobacter violaceus lacks thylakoid membranes, making its PSII architecture unique . Key functional attributes include:

  • Light Adaptation: PsbA2 is constitutively expressed under standard conditions but shows differential regulation under photoinhibitory stress. High irradiance upregulates psbAIII, while UVB stress suppresses psbA2 transcription, impairing PSII recovery .

  • Electron Transport: The protein’s Q(B) site binds plastoquinone, though Gloeobacter may utilize alternative quinones like menaquinone due to plastoquinone biosynthesis pathway deficiencies .

Comparative Analysis of PsbA Isoforms

Gloeobacter violaceus possesses five psbA genes (psbAI to psbAV), encoding three D1 isoforms. PsbA2 (encoded by psbAII) and PsbA1 (encoded by psbAI) are identical and dominate the transcript pool under non-stress conditions :

IsoformGeneExpression ProfileStress Response
PsbA1/2psbAI/IIConstitutive (~99% of transcripts)Repressed under UVB/high light
PsbA3psbAIIIInduced under high lightCritical for PSII repair
PsbA4/5psbAIV/VTrace expression (<1% of transcripts)No significant role in stress adaptation

Applications in Research

  • Photosystem II Studies: Recombinant PsbA2 enables structural and functional analyses of PSII in thylakoid-less cyanobacteria, offering insights into evolutionary adaptations .

  • ELISA Development: Commercially available as an antigen (1,698.00 €) for antibody production and diagnostic assays .

  • Stress Response Modeling: Used to study UVB and high-light-induced photodamage mechanisms, particularly D1 protein turnover dynamics .

Evolutionary Significance

PsbA2’s sequence divergence highlights evolutionary optimization for oxygenic photosynthesis. Notably, atypical D1 isoforms in nitrogen-fixing cyanobacteria (e.g., Cyanothece spp.) lack Mn4CaO5 cluster ligands, suggesting functional diversification for anaerobic metabolic compatibility .

Future Research Directions

  • Mechanistic Studies: Resolving PsbA2’s role in PSII repair complexes, particularly interactions with FtsH proteases .

  • Biotechnological Engineering: Leveraging recombinant PsbA2 to engineer stress-tolerant photosynthetic systems .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery information.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice packaging, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
psbA2; glr1706; Photosystem II protein D1 2; PSII D1 protein 2; Photosystem II Q(B protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Gloeobacter violaceus (strain PCC 7421)
Target Names
psbA2
Target Protein Sequence
MATILRRRSLGNPWEQFANWITSTDNRFYIGWFGVLMVPTLLSATICFVVAFIAAPPVDM DGIREPISGSLLYGNNIITGAVIPSSNAIGLHFYPIWEAASMDEWLYNGGPYQLVVFHFL IGIFAYLGREWEFSYRLGLRPWICVAYSAPVAAATAVFLIYPMGQGSFSDGMSLGISGTF NFMFIFQAEHNILNHPLHMFGVAGVFGGSLFAAMHGSLVTSSLIKATSYEESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFTNSRSLHFFLAAWPVIGIWLTSLGICVMGFNLNGF NFNASITDNQGRTIYTWADIVNRANLGIEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H(2)O, generating O(2) and a proton gradient that subsequently drives ATP formation. It comprises a core antenna complex for photon capture and an electron transfer chain responsible for converting photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Database Links

KEGG: gvi:gvip234

STRING: 251221.gvip234

Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Gloeobacter violaceus PsbA2 protein and how does it differ from other PsbA variants?

Gloeobacter violaceus PsbA2 is one of the three isoform variants of the PsbA (D1) reaction center protein found in Photosystem II of this cyanobacterium. The PsbA2 protein (encoded by psbAII/glr0779) is structurally identical to the PsbA1 protein (encoded by psbAI/glr2322), both representing the PsbA:2 form of the protein. These proteins function as core components of Photosystem II's reaction center, where they bind important cofactors involved in electron transport and are subject to high turnover rates under light stress .

Unlike PsbA proteins in most photosynthetic organisms, Gloeobacter's PsbA2 contains methionine at position 173 rather than the proline commonly found in other species. This amino acid difference impacts the electron transfer properties of the protein, particularly affecting the structural environment around TyrZ and modifying its redox properties . This distinct amino acid composition makes Gloeobacter's PsbA2 relatively unusual among photosynthetic organisms, with only a few other variants (such as PsbA0 in Anabaena with Met and D1-4 in Gloeobacter with Ser at this position) .

How many psbA genes exist in Gloeobacter violaceus and what is their genomic organization?

Gloeobacter violaceus possesses five psbA genes distributed throughout its 4.6 Mbp genome, encoding three distinct isoform variants of the PsbA (D1) reaction center protein . The five genes are:

  • psbAI (glr2322) - Encodes PsbA:2 form

  • psbAII (glr0779) - Encodes identical PsbA:2 form

  • psbAIII (gll3144) - Encodes a distinct variant

  • psbAIV (glr1706) - Encodes a divergent PsbA isoform

  • psbAV (glr2656) - Encodes another divergent PsbA isoform

In contrast to all other oxygenic phototrophs, where psbA genes typically do not cluster with other photosystem II genes, Gloeobacter violaceus shows a unique organization where one copy (psbA3) colocalizes with other PSII subunits . This represents a significant evolutionary distinction, as psbA3 is transcribed as part of a psbA3DC operon, encoding three reaction center core subunits: D1, D2, and CP43 . This organization is considered the first documented example of a transcribed gene cluster containing the D1/D2 or D1/D2/CP43 subunits in any oxygenic phototroph, either prokaryotic or eukaryotic.

What is the evolutionary significance of studying Gloeobacter violaceus PsbA2?

Gloeobacter violaceus holds particular evolutionary significance as it represents the earliest diverging oxyphotobacterium (cyanobacterium) on the 16S ribosomal RNA phylogenetic tree . Several unique characteristics make it an invaluable model for understanding photosynthetic evolution:

  • Lack of thylakoid membranes: Unlike all other known cyanobacteria, Gloeobacter lacks thylakoid membranes, forcing its photosynthetic machinery to operate within the cytoplasmic membrane .

  • Unique psbA operon structure: The psbA3DC operon in Gloeobacter represents a potentially ancestral configuration that may offer insights into the early evolution of oxygenic photosynthesis .

  • Distinct D1 protein variants: The presence of five psbA copies encoding three distinct D1 isoforms provides a model for studying functional diversification of this crucial photosynthetic protein .

  • Amino acid variations: The Met at position 173 in PsbA2 (instead of the common Pro) affects electron transfer properties and represents an unusual variant that may reflect evolutionary adaptations .

Studying PsbA2 in this organism can therefore provide crucial insights into the ancestral state of photosynthetic reaction centers and help reconstruct the evolutionary pathway that led to modern photosynthetic systems.

How are the different psbA genes in Gloeobacter violaceus expressed under standard growth conditions?

Under standard culture conditions, Gloeobacter violaceus expresses all five of its psbA genes, though their transcript abundances span 4.5 orders of magnitude, indicating highly differential expression . The expression pattern is characterized by:

  • psbAI (glr2322) and psbAII (glr0779): These genes, which encode identical PsbA:2 form proteins, are constitutively expressed and dominate the psbA transcript pool under control conditions .

  • psbAIII (gll3144): Shows lower baseline expression under normal conditions but is strongly responsive to environmental stressors .

  • psbAIV (glr1706) and psbAV (glr2656): These genes show consistent trace expression but never contribute significantly to the psbA transcript pool under standard conditions .

This expression pattern ensures that under normal growth conditions, the PsbA:2 form predominates in Gloeobacter's photosystems, suggesting this variant is optimized for standard light conditions.

How do environmental stressors affect psbA gene expression in Gloeobacter violaceus?

Environmental stressors trigger distinct transcriptional responses in the psbA gene family of Gloeobacter violaceus, revealing complex regulatory mechanisms:

  • High irradiance stress: Under photoinhibitory high light conditions, psbAIII (gll3144) is strongly induced, contributing to a large increase in the total psbA transcript pool . This upregulation allows cells to maintain their PsbA protein pools and recover from irradiance stress within one cellular generation .

  • UVB stress: When exposed to comparable photoinhibition provoked by UVB radiation, Gloeobacter cells show a distinctly different response. Unlike with high light, UVB exposure prevents cells from maintaining their psbA transcript and PsbA protein pools, resulting in limited recovery capacity .

  • Expression stability: Despite environmental stressors, psbAIV (glr1706) and psbAV (glr2656) maintain only trace expression levels and never become significant contributors to the psbA transcript pool, even under stress conditions .

This differential response to various light stressors suggests evolved regulatory mechanisms that optimize photoprotection dependent on the specific type of stress encountered.

What experimental approaches are most effective for studying psbA gene expression in Gloeobacter violaceus?

Based on the research methodologies described in the literature, effective approaches for studying psbA gene expression in Gloeobacter violaceus include:

  • Quantitative PCR (qPCR): This technique allows precise measurement of transcript abundance differences spanning several orders of magnitude, essential for detecting both the dominant psbAI/II transcripts and the trace psbAIV/V transcripts .

  • Site-directed mutagenesis: As demonstrated in studies of PsbA proteins, site-directed mutagenesis can be used to create specific amino acid substitutions (such as Met173Pro) to study structure-function relationships .

  • Confirmation of gene modifications: PCR amplification followed by restriction enzyme digestion can confirm successful gene modifications. For example, in similar studies with T. elongatus, Avr II digestion was used to confirm the PsbA2/Met173Pro mutation .

  • Spectroscopic analysis: Both EPR spectroscopy and time-resolved absorption spectroscopy provide valuable tools for examining the functional consequences of psbA variations, particularly regarding electron transfer properties .

  • Growth condition manipulation: Controlled experiments with varying light intensities and UVB exposure allow for systematic analysis of stress-responsive gene expression patterns .

These methodological approaches provide complementary data on both the transcriptional regulation and functional consequences of psbA gene expression.

What spectroscopic techniques are most useful for functional studies of recombinant Gloeobacter violaceus PsbA2?

For functional characterization of recombinant Gloeobacter violaceus PsbA2, several spectroscopic techniques have proven particularly valuable:

  • EPR Spectroscopy: Electron Paramagnetic Resonance spectroscopy has been effectively used to study the magnetic properties of TyrZ in PsbA variants . High-field EPR (235 GHz) is particularly useful for detecting subtle shifts in gx position that reflect changes in the electrostatic environment of the phenolic oxygen in different PsbA variants .

  • Time-resolved Absorption Spectroscopy: This technique allows researchers to measure the kinetics of electron transfer from TyrZ to P680+- in different redox states (S1, S2, S3), revealing how structural differences in PsbA variants affect electron transfer rates .

  • Flash-fluorescence Measurements: These measurements can detect modifications in the redox potential of key cofactors bound by the PsbA protein, providing insights into functional alterations in electron transport properties .

  • Oxygen Evolution Measurements: Using a Clark-type oxygen electrode with electron acceptors like 2,6-dichloro-p-benzoquinone provides quantitative measurement of photosystem II activity in preparations containing recombinant PsbA2 .

These complementary techniques provide a comprehensive picture of both structural and functional properties of PsbA2 variants.

What expression systems are most effective for producing recombinant Gloeobacter violaceus PsbA2?

Based on research protocols for similar photosynthetic proteins, effective expression systems for recombinant Gloeobacter violaceus PsbA2 include:

  • Homologous Expression in Cyanobacteria: Similar to approaches with Thermosynechococcus elongatus, transformation of Gloeobacter with expression constructs containing the psbA2 gene under control of strong promoters (such as the psbA3 promoter) can be effective . This approach maintains the native folding environment for membrane proteins.

  • Expression Vector Design: Effective vectors should include:

    • Appropriate promoter elements (like the psbA3 promoter)

    • Antibiotic resistance markers for selection (e.g., chloramphenicol, spectinomycin)

    • Homologous flanking regions for recombination

    • His-tagging for purification purposes

  • Transformation Protocol: Electroporation has been successfully used for transformation of cyanobacteria using Gene Pulser systems (e.g., Bio-Rad) .

  • Selection Strategy: Transformants can be selected on agar plates containing appropriate antibiotics (25 μg/mL spectinomycin, 10 μg/mL streptomycin, 40 μg/mL kanamycin, and 5 μg/mL chloramphenicol have been used for T. elongatus) .

  • Verification of Expression: PCR amplification followed by restriction digest analysis can confirm successful incorporation and expression of the modified gene .

These approaches maximize the likelihood of obtaining functional recombinant protein that retains native properties.

What site-directed mutagenesis approaches are most informative for studying Gloeobacter violaceus PsbA2 function?

Based on successful mutagenesis studies of similar PsbA proteins, the following approaches are particularly informative for studying Gloeobacter violaceus PsbA2:

  • Targeted Amino Acid Position 173: The Met173 position in PsbA2 is especially interesting since it differs from the Pro173 found in most other species. Creating a Met173Pro mutation allows direct comparison of how this amino acid affects electron transfer properties .

  • TyrZ Environment Mutations: Modifications affecting the TyrZ-His190 hydrogen bond network can provide insights into how structural changes impact electron transfer rates and redox properties .

  • Mutagenesis Methodology: Site-directed mutagenesis kits (such as the Site-directed Mutagenesis Lightning Kit from Stratagene) have been successfully used, incorporating unique restriction sites to facilitate screening of transformants .

  • Verification Methods:

    • PCR amplification of the target region

    • Restriction enzyme digestion using newly created restriction sites (Avr II sites were created for PsbA2/Met173Pro in similar studies)

    • DNA sequencing to confirm mutations

  • Functional Coupling Analysis: Creating mutations that mimic other PsbA variants (i.e., converting PsbA2 to resemble PsbA3 and vice versa) allows researchers to identify which amino acid differences are responsible for specific functional properties .

These approaches enable systematic exploration of structure-function relationships in the PsbA2 protein.

How do amino acid differences at position 173 in PsbA variants affect electron transfer properties?

Research on PsbA variants has revealed that the amino acid at position 173 plays a critical role in determining electron transfer properties:

  • Structural Impact: The amino acid at position 173 affects the protein structure in the vicinity of TyrZ, specifically influencing the hydrogen bond between the phenol group of TyrZ and D1/His190 .

  • Electron Transfer Kinetics: In studies comparing PsbA variants, when Pro173 is present (as in most species), electron transfer from TyrZ to P680+- is faster compared to when Met173 is present (as in Gloeobacter's PsbA2) .

  • Redox State Dependence: The effect on electron transfer rates can vary depending on the S-state of the oxygen-evolving complex. For example, in T. elongatus variants, the rate differences were observed in the S2 and S3 states but not in the S1 state .

  • Magnetic Properties: EPR spectroscopic studies show that the amino acid at position 173 affects the magnetic properties of TyrZ, with changes in the gx position reflecting alterations in the electrostatic environment of the phenolic oxygen .

  • Experimental Validation: Site-directed mutagenesis studies creating PsbA2/Met173Pro and PsbA3/Pro173Met mutants have confirmed that this single amino acid substitution is the main structural parameter affecting electron transfer between TyrZ and P680 in these proteins .

These findings highlight how a single amino acid variation can significantly impact the functional properties of a crucial photosynthetic protein.

What is the significance of the psbA3DC operon organization in Gloeobacter violaceus from an evolutionary perspective?

The unique psbA3DC operon organization in Gloeobacter violaceus holds significant evolutionary implications:

  • First Documented Example: This represents the first known example of a transcribed gene cluster containing the D1/D2 or D1/D2/CP43 subunits of Photosystem II in any oxygenic phototroph, either prokaryotic or eukaryotic .

  • Evolutionary Position: Gloeobacter violaceus is positioned at the earliest branch of the cyanobacterial tree based on 16S rRNA phylogenetic analysis, suggesting this gene organization may represent an ancestral state .

  • Relation to Anoxygenic Phototrophs: This operon organization shows some parallels to the synteny of reaction center genes in type 2 anoxygenic phototrophs, which are postulated to be evolutionary precursors to oxygenic PSII .

  • Contrast to Modern Cyanobacteria: In all other cyanobacteria with multiple psbA copies, these genes are typically regulated independently of other PSII genes and do not form operons .

  • Functional Implications: This gene clustering may have provided coordinated expression advantages during the early evolution of oxygenic photosynthesis, before the development of more complex regulatory mechanisms .

This unique genomic arrangement provides a potential glimpse into the evolutionary history of photosynthetic reaction centers and supports Gloeobacter's position as a living "molecular fossil" of early photosynthetic organisms.

How might differential expression of psbA genes contribute to stress adaptation in Gloeobacter violaceus?

The differential expression of psbA genes in Gloeobacter violaceus appears to be a sophisticated adaptation mechanism:

  • Stress-Specific Responses: Different environmental stressors trigger distinct transcriptional responses. While high irradiance stress induces psbAIII expression, UVB exposure leads to inability to maintain psbA transcript and protein pools .

  • Functional Adaptation: The expression of different PsbA variants with distinct electron transfer properties may optimize photosystem function for specific environmental conditions.

  • Recovery Capacity: The upregulation of psbAIII under high irradiance stress allows cells to maintain their PsbA protein pools and recover within one cellular generation, representing an effective adaptation strategy .

  • Baseline Stability: The constitutive expression of psbAI and psbAII under normal conditions ensures stable photosystem function during non-stress periods .

  • Limited Response Options: The inability to effectively respond to UVB stress suggests evolutionary limitations in Gloeobacter's stress adaptation mechanisms, possibly reflecting its early divergence before more sophisticated responses evolved .

This complex regulatory system demonstrates how even an early-diverging organism like Gloeobacter has evolved sophisticated transcriptional responses to optimize photosynthetic function under varying environmental conditions.

What are common challenges in working with recombinant Gloeobacter violaceus PsbA2 and how can they be addressed?

Researchers working with recombinant Gloeobacter violaceus PsbA2 typically encounter several challenges:

  • Slow Growth Rates: Gloeobacter violaceus is a slow-growing cyanobacterium, which can extend experimental timelines. Optimization of growth conditions (CO2-enriched atmosphere at 45°C under continuous light of approximately 80 μmol of photons m⁻² s⁻¹) can improve growth rates .

  • Expression Level Verification: Given the large differences in natural expression levels among psbA genes, verifying expression of recombinant constructs requires sensitive detection methods. Quantitative PCR is recommended for accurate transcript quantification .

  • Photosynthetic Activity Assessment: When studying recombinant PsbA2 variants, oxygen evolution measurements using a Clark-type oxygen electrode with appropriate electron acceptors (such as 2,6-dichloro-p-benzoquinone) provide quantitative assessment of functional activity .

  • Protein Purification: For structural and functional studies, purification of His-tagged PSII complexes can be achieved using Ni²⁺-affinity chromatography followed by additional purification steps to obtain homogeneous preparations .

  • Segregation Verification: When creating mutants, ensuring complete segregation of all genome copies is essential. This can be confirmed by PCR amplification of relevant DNA fragments followed by restriction enzyme digestion to verify the presence of introduced mutations .

Addressing these challenges requires careful experimental design and optimization of protocols specific to Gloeobacter's unique characteristics.

How can researchers interpret contradictory results regarding PsbA2 function across different experimental systems?

When encountering contradictory results in PsbA2 functional studies, researchers should consider:

  • Expression Context Differences: Results may vary depending on whether PsbA2 is studied in its native context versus heterologous expression systems. The protein's function may be influenced by:

    • Membrane environment differences

    • Presence/absence of interacting proteins

    • Post-translational modifications

  • Measurement Technique Variations: Different spectroscopic techniques may produce apparently contradictory results due to:

    • Differences in time scales of measurement

    • Sample preparation methods

    • Environmental conditions during measurement

    • Instrument sensitivity and resolution

  • Genetic Background Effects: When studying PsbA2 in mutant backgrounds, the presence of other PsbA variants at low levels may confound results. Verification of complete segregation is essential .

  • Environmental Condition Standardization: Light intensity, temperature, and growth phase can significantly impact PsbA2 function. Standardizing these conditions across experiments is crucial for comparable results.

  • Redox State Considerations: The functional effects of PsbA2 variations may depend on the S-state of the oxygen-evolving complex, as seen in the differential effects observed in S1 versus S2/S3 states in similar studies .

Careful documentation of all experimental conditions and comprehensive control experiments are essential for resolving apparent contradictions in experimental outcomes.

What critical controls should be included when characterizing recombinant Gloeobacter violaceus PsbA2 proteins?

When characterizing recombinant Gloeobacter violaceus PsbA2 proteins, several critical controls should be included:

  • Wild-type PsbA2 Expression: Maintaining a wild-type PsbA2 expression strain as a positive control allows direct comparison with mutant variants. This is particularly important when studying the effects of site-directed mutations .

  • Empty Vector Controls: Expression strains containing the vector backbone without the psbA2 gene provide negative controls to account for effects of the expression system itself.

  • Oxygen Evolution Measurements: Quantitative assessment of oxygen evolution rates with appropriate electron acceptors (e.g., 2,6-dichloro-p-benzoquinone) provides functional validation of recombinant proteins .

  • Protein Expression Verification: Western blot analysis with antibodies against PsbA (D1) protein confirms successful expression of recombinant proteins and allows quantitative comparison of expression levels.

  • Genomic Segregation Controls: For mutant strains, PCR amplification followed by restriction enzyme digestion (using engineered restriction sites) confirms complete segregation of all genome copies .

  • Spectroscopic Reference Standards: When performing EPR or time-resolved absorption spectroscopy, include well-characterized reference samples to validate instrument performance and facilitate comparison with published results .

Incorporating these controls ensures robust experimental design and facilitates accurate interpretation of results from recombinant PsbA2 studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.