Recombinant Gloeobacter violaceus Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Functional Role of Lgt in Bacterial Lipoprotein Biosynthesis

Lgt catalyzes the first step in bacterial lipoprotein maturation, transferring a diacylglyceryl group from phosphatidylglycerol to the conserved cysteine residue of prolipoproteins . This modification is critical for anchoring lipoproteins to bacterial membranes, including the outer membrane in Gram-negative bacteria and plasma membrane in Gram-positive bacteria. Lipoproteins are essential for membrane stability, nutrient transport, and pathogenesis .

Key Features of Lgt Activity:

FeatureDetailSource
SubstratesPhosphatidylglycerol (donor), prolipoprotein (acceptor)
Reaction MechanismFormation of a thioester acyl-enzyme intermediate
Catalytic ResiduesConserved residues (e.g., Y26, N146, G154 in E. coli) are essential for activity

Evolutionary Context of Gloeobacter violaceus Lgt

Gloeobacter violaceus is a primitive cyanobacterium lacking thylakoids, with photosynthetic machinery localized to the plasma membrane . While its Lgt has not been directly studied, homologs in other cyanobacteria and Gram-negative bacteria share conserved structural motifs .

Comparative Analysis of Lgt Across Bacteria:

OrganismLgt CharacteristicsReferences
Escherichia coli7 transmembrane segments; N-terminus faces periplasm; C-terminus cytoplasmic
Bacillus subtilisSimilar membrane topology; essential for growth
Gloeobacter violaceusPutative membrane-bound enzyme; evolutionary conservation inferred from homologs

Recombinant Lgt Production and Applications

Recombinant Lgt enzymes are typically expressed in heterologous systems (e.g., E. coli) for biochemical studies. While Gloeobacter Lgt has not been extensively characterized, recombinant production strategies mirror those for other Lgt homologs:

Recombinant Lgt Expression Workflow:

  1. Cloning: lgt gene amplification from Gloeobacter genomic DNA or synthetic constructs.

  2. Expression: Use of His-tagged fusion proteins for purification via metal-affinity chromatography .

  3. Purification: Solubilization under denaturing conditions followed by refolding .

Research Gaps and Future Directions

  1. Structural Characterization:

    • No crystal structures of Gloeobacter Lgt exist. Comparative modeling with E. coli Lgt (PDB: 4Q6T) could infer substrate-binding sites.

  2. Enzyme Kinetics:

    • E. coli Lgt has an IC₅₀ of 0.18–0.24 μM for inhibitors , but kinetic parameters (e.g., K<sub>m</sub>, V<sub>max</sub>) for Gloeobacter Lgt remain unknown.

  3. Evolutionary Significance:

    • Gloeobacter’s Lgt may lack thylakoid-associated adaptations seen in other cyanobacteria, offering insights into ancestral lipoprotein biogenesis pathways .

Potential Applications in Biotechnology

  1. Antibacterial Target:

    • Lgt inhibition disrupts lipoprotein maturation, causing outer membrane permeabilization and bactericidal effects . Gloeobacter Lgt could serve as a model for developing broad-spectrum inhibitors.

  2. Membrane Protein Studies:

    • Recombinant Lgt may aid in reconstituting bacterial membrane biogenesis systems for structural biology applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
lgt; gll4393; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Gloeobacter violaceus (strain PCC 7421)
Target Names
lgt
Target Protein Sequence
MPMETGFTSPGPLIVQIGGFAVRWYSLLILAGIIAGTLLSQKLAPERKVAPEVLSDLVVW LVVGAIPMARLYYVLFEWQRFAGEPWWKVFAIWEGGIAIHGAILGGLLAGWLFCRRNGYS LLTMIDLAAPGLILGQAIGRWGNFFNSEAYGAPTNLPWKLFIPEANRPPGMAAFAYYHPT FLYESLWNLGVLALLLFVFFRFKNLRPGSIACLYALAYSVGRFWIEGLRLDSLMVGPLRT AQLVSLAGIVLGAVGLWWLNRRSARQEAP
Uniprot No.

Target Background

Function

Function: Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the N-terminal cysteine sulfhydryl group of a prolipoprotein. This is the initial step in mature lipoprotein formation.

Database Links

KEGG: gvi:gll4393

STRING: 251221.gll4393

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.