Recombinant Gloeobacter violaceus UPF0754 membrane protein glr0504 (glr0504)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
glr0504; UPF0754 membrane protein glr0504
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-429
Protein Length
full length protein
Species
Gloeobacter violaceus (strain PCC 7421)
Target Names
glr0504
Target Protein Sequence
MQVAATSIKPAGTGGWKLALTIVHYVLPPIVGALIGFTSDTLAIKMLFRPYKPKYFLGRQ IPLTPGLFPKGQERFARKVAQMLTDKLLTPDEVHRIAQRLLTPERLEEGLRFALLYALGE YSDGRKRARLAVALGDILQEVFSESLPKWIDALSRSSASNKIFEQIFDQVAGSLRIEEAQ AVRLAEWIEKNVFTPDRLRLALINLLTNQTIDTLDKEARERAQGGLWLVANVVGIKGPLS RFKSFCVEQPEAANELFTRFLAEAEVRERLTGALNGLSVQTLSMATVQDLKRQFVTSLTA ALSAQGPGLSQRLGESIDWSRWAAEVLDRVVTSEKTLGWIDRIAEGSSRLLDRYLTRELE PLVMKFLPALGLEQMVITKICNTSPQELEAAIEQVARNELRAIPYVGMVLGFCVGLFEVF LITVVIPVG
Uniprot No.

Target Background

Database Links

KEGG: gvi:glr0504

STRING: 251221.glr0504

Protein Families
UPF0754 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Gloeobacter violaceus UPF0754 membrane protein glr0504?

Gloeobacter violaceus UPF0754 membrane protein glr0504 is a membrane-associated protein encoded by the glr0504 gene in the cyanobacterium Gloeobacter violaceus strain PCC 7421. It belongs to the UPF0754 protein family, with a full amino acid sequence consisting of 429 amino acids . This protein is characterized by its hydrophobic regions that facilitate integration into cellular membranes, suggesting potential roles in membrane transport, signaling, or structural organization . The protein has been assigned the UniProt accession number Q7NNA7, which serves as its definitive identifier in protein databases .

What structural features characterize the glr0504 protein?

The glr0504 protein exhibits several notable structural characteristics that influence its function and experimental handling:

  • The protein contains multiple hydrophobic segments characteristic of transmembrane domains, as evidenced by stretches of hydrophobic residues in its sequence (e.g., "ALTIVHYVLPPIYGALIGFTSDTL") .

  • The amino acid sequence reveals potential functional domains, including:

    • N-terminal region (MQVAATSIKPAGTGGWKL) that likely faces the cytoplasmic side

    • Multiple alpha-helical transmembrane segments

    • C-terminal domain (MVLGFCVGLFEVFLITVVIPVG) that anchors the protein in the membrane

  • The protein's full amino acid sequence suggests a complex tertiary structure with multiple membrane-spanning regions interspersed with hydrophilic loops that may participate in protein-protein interactions or substrate binding .

What are the optimal storage conditions for maintaining glr0504 protein stability?

Maintaining protein stability is crucial for experimental reproducibility when working with recombinant glr0504. Based on empirical data, the following storage protocols are recommended:

  • For short-term storage (up to one week), maintain aliquots at 4°C in a Tris-based buffer with 50% glycerol formulation that has been optimized specifically for this protein .

  • For medium-term storage, maintain the protein at -20°C in the same buffer composition .

  • For extended storage periods, conservation at -80°C is recommended to minimize degradation and maintain functional integrity .

  • Repeated freeze-thaw cycles significantly compromise protein stability and should be strictly avoided; working aliquots should be prepared to minimize this issue .

How should researchers design experiments to investigate glr0504 function?

When designing experiments to investigate glr0504 function, researchers should implement a structured experimental framework:

MethodologyApplication for glr0504 ResearchKey Consideration
Site-directed mutagenesisIdentify critical residues for functionTarget conserved amino acids based on sequence analysis
Fluorescence-based assaysMonitor transport or binding activitiesRequires careful selection of fluorophores to avoid interference with membrane environment
ElectrophysiologyAssess channel or transport propertiesRequires reconstitution in appropriate membrane systems
Structural biologyDetermine three-dimensional structureMay require detergent optimization for membrane protein stability

What expression systems are most effective for recombinant production of glr0504?

Selecting an appropriate expression system is critical for obtaining functional recombinant glr0504 protein. Based on general principles for membrane protein expression:

  • E. coli-based expression systems:

    • Advantages: Rapid growth, high yields, and extensive genetic tools

    • Limitations: May form inclusion bodies requiring refolding

    • Recommendation: Use C41(DE3) or C43(DE3) strains specifically developed for membrane protein expression

  • Yeast expression systems (P. pastoris or S. cerevisiae):

    • Advantages: Eukaryotic processing machinery and lipid composition more similar to higher organisms

    • Limitations: Longer development time than bacterial systems

    • Recommendation: Consider for studies requiring post-translational modifications

  • Insect cell expression systems:

    • Advantages: Complex folding machinery suitable for multi-domain membrane proteins

    • Limitations: Higher cost and more complex methodology

    • Recommendation: Optimal for structural studies requiring large quantities of properly folded protein

  • Cell-free expression systems:

    • Advantages: Direct incorporation into artificial membrane environments

    • Limitations: Lower yields but potentially higher functional relevance

    • Recommendation: Useful for functional assays requiring minimal purification steps

The choice should be guided by the specific research objectives, with consideration for experimental endpoints (structural studies, functional assays, or interaction analyses) .

How can researchers optimize purification protocols for glr0504?

Purification of membrane proteins like glr0504 presents unique challenges due to their hydrophobic nature. A systematic approach to optimization includes:

  • Detergent screening:

    • Begin with a panel of detergents varying in critical micelle concentration and micelle size

    • Evaluate protein stability and activity retention after solubilization

    • Common effective detergents include DDM, LMNG, and digitonin for maintaining membrane protein structure

  • Affinity purification considerations:

    • The tag type for recombinant glr0504 is determined during the production process and should be selected based on experimental requirements

    • Position the affinity tag (N or C-terminal) based on predicted topology to ensure accessibility

    • Include protease inhibitors throughout purification to prevent degradation

  • Size exclusion chromatography:

    • Critical for assessing protein homogeneity and removing aggregates

    • Select column matrix based on expected protein-detergent complex size

    • Monitor peak symmetry as an indicator of proper folding

  • Buffer optimization:

    • The recommended storage buffer (Tris-based with 50% glycerol) has been specifically optimized for glr0504 stability

    • Systematically test pH ranges and ionic strength

    • Consider inclusion of lipids to maintain native-like environment

  • Quality control metrics:

    • Circular dichroism to verify secondary structure integrity

    • Thermal stability assays to assess protein stability under various conditions

    • Functional assays specific to predicted protein activity

What methodological approaches can resolve conflicting data about glr0504 function?

When researchers encounter conflicting data regarding glr0504 function, a multi-faceted methodological approach can help resolve discrepancies:

  • Implement triangulation methodologies:

    • Employ multiple complementary techniques to investigate the same question

    • Compare results across different experimental conditions and systems

    • Determine whether conflicts arise from methodological limitations or biological complexity

  • Conduct systematic parameter variation studies:

    • Systematically vary experimental conditions (pH, temperature, lipid composition)

    • Create a comprehensive parameter space to identify condition-dependent functional changes

    • Document precisely where functional differences emerge to pinpoint potential regulatory mechanisms

  • Develop robust validation protocols:

    • Design experiments with appropriate statistical power to detect meaningful differences

    • Implement blinded analysis procedures to reduce experimenter bias

    • Pre-register experimental protocols and analysis plans to enhance reproducibility

  • Integrate computational and experimental approaches:

    • Use molecular dynamics simulations to predict protein behavior under conditions difficult to test experimentally

    • Employ machine learning to identify patterns in complex datasets that may explain apparent contradictions

    • Validate computational predictions with targeted experimental designs

  • Collaborative cross-laboratory validation:

    • Establish standardized protocols across research groups

    • Exchange materials (protein preparations, cell lines) to eliminate preparation variables

    • Implement round-robin testing with identical samples to identify laboratory-specific factors

What computational modeling techniques are most appropriate for predicting glr0504 interactions?

Advanced computational approaches can provide valuable insights into potential glr0504 interactions with other molecules:

  • Homology modeling and threading approaches:

    • Utilize the complete amino acid sequence (429 amino acids) to generate structural models based on related proteins

    • Assess model quality using validation tools (PROCHECK, VERIFY3D)

    • Generate multiple models using different templates to assess structural convergence

  • Molecular docking for protein-protein interactions:

    • Perform unbiased global docking to identify potential interaction interfaces

    • Refine interactions with focused local docking

    • Validate predictions with targeted mutagenesis experiments

  • Molecular dynamics simulations in membrane environments:

    • Embed modeled protein in appropriate lipid bilayer compositions

    • Simulate protein behavior under physiologically relevant conditions

    • Analyze dynamics to identify stable conformational states and transition pathways

  • Network analysis of protein-protein interactions:

    • Integrate experimental interaction data with computational predictions

    • Apply graph theory approaches to identify key nodes in interaction networks

    • Predict functional consequences of disrupting specific interactions

  • Machine learning integration:

    • Train models using known membrane protein interaction datasets

    • Identify sequence and structural features predictive of interaction potential

    • Apply trained models to predict novel interaction partners for experimental validation

How can researchers design experiments to elucidate the physiological role of glr0504 in Gloeobacter violaceus?

Determining the physiological significance of glr0504 requires a comprehensive experimental strategy:

  • Gene knockout/knockdown studies:

    • Generate complete knockout or conditional expression strains

    • Conduct comprehensive phenotypic analysis under various growth conditions

    • Perform complementation studies to verify phenotype specificity

  • Localization studies within native context:

    • Develop fluorescent protein fusions that maintain protein function

    • Implement super-resolution microscopy to precisely map subcellular distribution

    • Conduct co-localization studies with known membrane components

  • Temporal expression analysis:

    • Monitor expression patterns under various environmental conditions

    • Correlate expression changes with physiological responses

    • Identify potential regulatory elements controlling expression

  • Interactome mapping:

    • Implement proximity labeling techniques (BioID, APEX) in the native organism

    • Perform co-immunoprecipitation studies followed by mass spectrometry

    • Validate key interactions with orthogonal methods

  • Comparative genomics approach:

    • Analyze distribution and conservation of glr0504 across related species

    • Correlate presence/absence with specific physiological capabilities

    • Identify co-evolving genes that may function in common pathways

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Identify pathways affected by glr0504 manipulation

    • Generate testable hypotheses about physiological roles based on integrated analysis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.