Recombinant Gloydius blomhoffii Cytochrome b (MT-CYB)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is synthesized using E. coli expression systems to ensure high yield and purity . Product specifications include:

ParameterDetail
Expression SystemE. coli (in vitro)
Tag TypeDetermined during production (commonly His-tag or GST)
Storage BufferTris-based buffer with 50% glycerol
StabilityStore at –20°C; avoid repeated freeze-thaw cycles

Multiple isoforms are available, including partial sequences expressed in yeast, baculovirus, and mammalian cells .

Antibody Development

This recombinant protein serves as an antigen for generating antibodies (e.g., CSB-PA581286) validated in ELISA and immunohistochemistry .

Drug Sensitivity Studies

MT-CYB variants influence responses to pharmaceuticals. For example:

  • The yeast model revealed that mutations in MT-CYB (e.g., p.Asp171Asn) alter sensitivity to atovaquone (antimalarial) and clomipramine (antidepressant) .

  • Pathogenic mutations like M4T (m.14757T>C) impair Complex III activity, linked to dilated cardiomyopathy .

Clinical and Pathological Relevance

Mutation/StudyImpactCitation
m.14757T>C (M4T)Reduces Complex III activity by 60%, associated with cardiomyopathy
p.Asp171Asn (m.15257G>A)Enhances atovaquone sensitivity in yeast models
p.Phe18Leu (m.14798T>C)Increases clomipramine sensitivity in glioblastoma cells

Limitations and Future Directions

Current challenges include:

  • Incomplete structural data for Gloydius blomhoffii-specific isoforms.

  • Limited in vivo functional studies outside yeast models .
    Future research could explore transgenic animal models to validate pathogenicity of MT-CYB mutations .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
MT-CYB; COB; CYTB; MTCYB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-214
Protein Length
full length protein
Species
Gloydius blomhoffii (Mamushi) (Agkistrodon halys blomhoffi)
Target Names
Target Protein Sequence
YINYKNMSHQHMLMMFNLLPVGSNISIWWNFGSMLLTCLVIQIMTGFFLAFHYTANINLA FSSIIHTSRDVPYGWIMQNTHAIGASLFFICIYIHIARGIYYGSYLNKEVWVSGTTLLIL LMATAFFGYVLPWGQMSFWAATVITNLLTAIPYFGTTLTTWLWGGFAINDPTLTRFFALH FILPFTIISASSIHILLLHNEGSNNPLGSNSDID
Uniprot No.

Target Background

Function
Recombinant *Gloydius blomhoffii* Cytochrome b (MT-CYB) is a component of the ubiquinol-cytochrome c reductase complex (Complex III or cytochrome b-c1 complex) within the mitochondrial respiratory chain. This complex facilitates electron transfer from ubiquinol to cytochrome c, contributing to the generation of a proton gradient across the mitochondrial membrane, which is essential for ATP synthesis.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental structure of Gloydius blomhoffii Cytochrome b?

Gloydius blomhoffii Cytochrome b is a mitochondrial membrane protein consisting of 214 amino acids as indicated by the computed structure model available in the RCSB PDB database (AF_AFP92852F1) . The protein's UniProt accession number is P92852. The amino acid sequence includes:

YINYKNMSHQHMLMMFNLLPVGSNISIWWNFGSMLLTCLVIQIMTGFFLAFHYTANINLAFSSIIHTSRDVPYGWIMQNTHAIGASLFFICIYIHIARGIYYGSYLNKEVWVSGTTLLILLMATAFFGYVLPWGQMSFWAATVITNLLTAIPYFGTTLTTWLWGGFAINDPTLTRFFALH FILPFTIISASSIHILLLHNEGSNNPLGSNSDID

The structure has been computationally modeled using AlphaFold with high confidence, showing a global pLDDT (predicted Local Distance Difference Test) score of 91.99, indicating very high model reliability . This score suggests that the predicted structure is likely to be accurate and can be used with confidence for further studies.

The cytochrome b protein typically contains multiple transmembrane helices that anchor it within the inner mitochondrial membrane, where it functions as part of the electron transport chain, specifically in complex III (ubiquinol-cytochrome c reductase). The protein is encoded by the mitochondrial genome, specifically by the MT-CYB gene, also known as COB, CYTB, or MTCYB .

How does Gloydius blomhoffii Cytochrome b function in the mitochondrial respiratory chain?

Gloydius blomhoffii Cytochrome b functions as a critical component of the mitochondrial electron transport chain, specifically as part of Complex III (also known as ubiquinol-cytochrome c reductase complex). Within this complex, cytochrome b is designated as subunit 3 . Its primary function involves:

  • Electron transfer: Cytochrome b accepts electrons from ubiquinol and transfers them to cytochrome c1 within Complex III.

  • Proton translocation: During electron transfer, the protein helps create a proton gradient across the inner mitochondrial membrane.

  • Energy conversion: The proton gradient generated by this and other respiratory complexes drives ATP synthesis via ATP synthase.

The highly conserved nature of cytochrome b across species reflects its essential role in cellular respiration. It contains binding sites for both ubiquinol and inhibitors like antimycin, making it crucial for understanding mitochondrial function and dysfunction.

In snakes like Gloydius blomhoffii, cytochrome b may have additional specialized adaptations related to their unique metabolism, particularly in relation to their low metabolic rates during periods of inactivity and their ability to significantly upregulate metabolism during feeding or activity.

What evolutionary insights can be gleaned from Gloydius blomhoffii Cytochrome b?

Cytochrome b is highly conserved across species, making it valuable for evolutionary studies. The MT-CYB gene has been widely used as a molecular marker in phylogenetic studies of vertebrates, including snakes. The specific characteristics of Gloydius blomhoffii Cytochrome b can provide several evolutionary insights:

  • Taxonomic relationships: Cytochrome b sequence analysis has contributed to reclassification of snake species, including the renaming of Agkistrodon blomhoffii to Gloydius blomhoffii .

  • Adaptation mechanisms: Comparing cytochrome b sequences across snake species may reveal adaptive changes related to metabolic requirements, environmental adaptations, or specialized physiological traits.

  • Mitochondrial evolution: The study of snake cytochrome b can contribute to our understanding of mitochondrial genome evolution, particularly in terms of selection pressures on respiratory chain components.

  • Molecular clock analyses: The relatively constant rate of mutation in cytochrome b makes it useful for estimating divergence times between different snake lineages.

The study of Gloydius blomhoffii Cytochrome b in relation to other species provides valuable data for constructing phylogenetic trees and understanding the evolutionary history of venomous snakes within the broader context of reptile evolution.

What are the optimal methods for producing and purifying Recombinant Gloydius blomhoffii Cytochrome b?

The production of Recombinant Gloydius blomhoffii Cytochrome b requires careful consideration of expression systems and purification strategies. Based on analogous approaches used for similar proteins, the following methodological framework is recommended:

Expression System Selection:

  • Bacterial expression: E. coli BL21(DE3) pLys strain has been successfully used for expressing recombinant proteins similar to Gloydius blomhoffii Cytochrome b . This system allows for high yield production, although membrane proteins often form inclusion bodies.

  • Cloning strategy: The gene of interest should be PCR-amplified from cDNA with appropriate restriction sites (e.g., NdeI and BamHI) introduced via primers. The amplified product can then be inserted into an expression vector such as pET16b, which provides a His-tag for purification .

Expression Protocol:

  • Transform the expression plasmid into the selected E. coli strain.

  • Culture cells at 37°C until reaching mid-log phase (OD600 ~0.6).

  • Induce protein expression with 1mM IPTG for 4 hours at 37°C .

  • Harvest cells by centrifugation and resuspend in an appropriate buffer (e.g., 50mM Tris-HCl, pH 7.5).

Purification Steps:

  • Cell lysis: Sonicate the cell suspension to release proteins.

  • Centrifugation: Separate inclusion bodies from soluble proteins.

  • Inclusion body washing: Wash with buffer containing 4% Triton X-100 followed by pure water .

  • Protein solubilization: If the protein forms inclusion bodies, solubilize using 6-8M urea or guanidine hydrochloride.

  • Affinity chromatography: Purify using Ni-NTA or similar affinity resin if a His-tag is present.

  • Refolding: If necessary, refold the protein by gradual dialysis to remove denaturants.

  • Further purification: Size exclusion or ion exchange chromatography may be employed for additional purification.

Storage Conditions:
The purified recombinant protein can be stored in Tris-based buffer with 50% glycerol at -20°C. For extended storage, -80°C is recommended to maintain stability .

What techniques are most effective for studying the structural characteristics of Gloydius blomhoffii Cytochrome b?

Several complementary techniques can be employed to comprehensively characterize the structural properties of Gloydius blomhoffii Cytochrome b:

Computational Structure Prediction:
AlphaFold or similar AI-based structure prediction tools have proven highly effective, as evidenced by the high-confidence model (pLDDT score of 91.99) available for this protein . These predictions provide valuable initial structural insights, particularly for proteins that are challenging to crystallize.

X-ray Crystallography:
Despite challenges in crystallizing membrane proteins, X-ray crystallography remains the gold standard for high-resolution structural determination. For cytochrome b, this typically requires:

  • Detergent solubilization and purification

  • Crystallization screening with various conditions and detergents

  • Data collection at synchrotron facilities

  • Structure solution and refinement

Cryo-Electron Microscopy (Cryo-EM):
Increasingly used for membrane protein structure determination, cryo-EM may be particularly valuable for Gloydius blomhoffii Cytochrome b, especially if studied within the context of the entire Complex III.

Circular Dichroism (CD) Spectroscopy:
CD can provide information about secondary structure content and conformational changes under different conditions, offering a relatively quick assessment of protein folding.

NMR Spectroscopy:
While challenging for a protein of this size, specific NMR techniques could provide information about dynamics and ligand binding.

Structure Validation:
Model quality assessment tools can be used to evaluate confidence levels of different regions, as seen in the pLDDT scoring of the AlphaFold model . The structure should be validated against experimental data when available.

The following table summarizes key structural analysis techniques:

TechniqueResolution RangeAdvantagesLimitationsApplication to Cytochrome b
AlphaFold PredictionN/ARapid, works with sequence onlyRequires validationFull structure predicted with high confidence
X-ray Crystallography0.5-3.0 ÅHigh resolutionRequires crystalsChallenging but definitive if successful
Cryo-EM2.5-4.0 ÅNo crystals neededEquipment intensiveSuitable for Complex III structure
CD SpectroscopyLowQuick, requires little proteinLimited detailSecondary structure assessment
NMR SpectroscopyAtomicDynamic informationSize limitationSpecific regions or interactions

How can researchers validate the functional integrity of purified Recombinant Gloydius blomhoffii Cytochrome b?

Validating the functional integrity of purified Recombinant Gloydius blomhoffii Cytochrome b is essential to ensure that experimental results are meaningful and reproducible. Several complementary approaches are recommended:

Spectroscopic Analysis:

  • UV-visible spectroscopy: Cytochrome b exhibits characteristic absorption spectra in its reduced and oxidized states. The α and β bands in the reduced spectrum (typically around 560 nm and 530 nm) should be examined.

  • Redox potential measurements: Determining the midpoint potentials of the heme centers using potentiometric titrations can confirm proper incorporation of heme groups.

Protein-Protein Interaction Assays:

  • Surface plasmon resonance (SPR): This technique has been successfully used to study interactions between snake proteins and cytochrome c, with dissociation constants as low as 1.05 × 10^-10 M being measured . Similar approaches could validate Gloydius blomhoffii Cytochrome b interactions with its natural partners.

  • Co-immunoprecipitation: Using antibodies against cytochrome b or its known interaction partners to precipitate protein complexes from solution.

Functional Assays:

  • Electron transfer activity: Measuring the ability of cytochrome b to transfer electrons within reconstituted systems or membrane preparations.

  • Binding assays: Evaluating the binding of specific inhibitors or substrates known to interact with cytochrome b.

Structural Integrity Assessment:

  • Circular dichroism (CD) spectroscopy: To verify secondary structure content.

  • Thermal stability assays: Using differential scanning fluorimetry (DSF) or related techniques to assess protein stability.

  • Limited proteolysis: To verify proper folding, as properly folded proteins typically show resistance to proteolysis at specific sites.

Immunodetection:
Western blotting using specific antibodies against Gloydius blomhoffii Cytochrome b can confirm protein identity and integrity. This approach has been used effectively for detecting related proteins in previous studies .

A systematic approach combining multiple validation methods provides the most comprehensive assessment of functional integrity, ensuring that the recombinant protein faithfully represents the native state of Gloydius blomhoffii Cytochrome b.

How does Gloydius blomhoffii Cytochrome b research inform our understanding of mitochondrial diseases?

Research on Gloydius blomhoffii Cytochrome b provides valuable insights into mitochondrial diseases through comparative analysis with human cytochrome b. The study of this snake protein offers several avenues for understanding mitochondrial pathology:

  • Structure-Function Relationships: The high-confidence structural model of Gloydius blomhoffii Cytochrome b (pLDDT score: 91.99) provides a template for understanding how specific mutations might disrupt protein function. This is particularly relevant as mutations in human MTCYB have been linked to various clinical presentations.

  • Disease Mechanism Models: Human cytochrome b mutations have been associated with isolated mitochondrial myopathy, exercise intolerance, and in rare cases, more complex disorders like parkinsonism/MELAS overlap syndrome . The study of the snake ortholog provides an evolutionary perspective on these pathogenic mechanisms.

  • Mutation Effects Analysis: A specific case study revealed that a novel mutation (m.14864 T>C) in human MTCYB, changing a conserved cysteine to arginine at position 40, resulted in a MELAS-like phenotype with migraines, epilepsy, sensorimotor neuropathy, and strokelike episodes . Comparative analysis with the snake cytochrome b can help elucidate why certain residues are critical for function.

  • Heteroplasmy Models: The clinical case mentioned above exhibited heteroplasmy (varying proportions of mutant mtDNA) in different tissues . Studying the snake protein can help develop models for understanding how varying levels of mitochondrial dysfunction affect different tissues.

  • Therapeutic Target Identification: Understanding the structural and functional differences between snake and human cytochrome b can potentially identify regions that could be targeted for therapeutic intervention in mitochondrial diseases.

The significance of this research extends beyond academic interest, as MTCYB must now "be included in the already long list of mitochondrial DNA genes that have been associated with the MELAS phenotype" , highlighting the clinical relevance of cytochrome b research.

What role does Recombinant Gloydius blomhoffii Cytochrome b play in studying protein-protein interactions?

Recombinant Gloydius blomhoffii Cytochrome b serves as an important model for understanding specific protein-protein interactions that may have evolutionary and functional significance. These interactions provide insight into both mitochondrial function and specialized adaptations in venomous snakes:

  • Cytochrome c Interactions: Studies on related snake species have shown that proteins like phospholipase A2 inhibitory protein (PLIβ) from Gloydius brevicaudus can bind cytochrome c with high affinity. The dissociation constant for this interaction was measured at 1.05 × 10^-10 M for horse cytochrome c and 2.37 × 10^-12 M for snake cytochrome c . These findings suggest that similar interactions might exist for Gloydius blomhoffii Cytochrome b.

  • Leucine-Rich α2-Glycoprotein (LRG) Connections: Human LRG, which shares 33% sequence identity with snake PLIβ, has been shown to bind cytochrome c with extraordinary affinity (dissociation constant of 1.58 × 10^-13 M for horse cytochrome c) . This suggests evolutionary conservation of cytochrome binding proteins across species.

  • Methodology for Interaction Studies: Surface plasmon resonance (SPR) analysis has proven effective in quantifying these interactions , providing a methodological framework for studying Gloydius blomhoffii Cytochrome b interactions.

  • Functional Implications: The binding of cytochrome c to PLIβ has been shown to suppress the phospholipase A2 inhibitory activity of PLIβ , suggesting complex regulatory mechanisms that may also apply to cytochrome b interactions.

  • Physiological Relevance: Research suggests that "autologous Cyt c is an endogeneous ligand for LRG and PLIβ and that these serum proteins neutralize the autologous Cyt c released from the dead cells" . This indicates potential roles in innate immunity and cellular damage response that may extend to cytochrome b-related pathways.

These protein interaction studies not only illuminate the functional aspects of Gloydius blomhoffii Cytochrome b but also provide insights into the evolution of protein interaction networks that may have implications for understanding human mitochondrial protein interactions and their dysfunction in disease states.

How can researchers leverage Recombinant Gloydius blomhoffii Cytochrome b for developing novel experimental systems?

Recombinant Gloydius blomhoffii Cytochrome b offers unique opportunities for developing experimental systems that address fundamental questions in biochemistry, evolution, and biomedical research:

  • Reconstituted Mitochondrial Complexes: Researchers can use the recombinant protein to reconstruct partial or complete respiratory chain complexes in vitro. This approach allows for:

    • Systematic manipulation of complex composition

    • Introduction of site-specific mutations to test structure-function hypotheses

    • Comparative studies with human or other species' components to identify functionally critical differences

  • Protein Engineering Platforms: The high-confidence structural model (pLDDT score: 91.99) provides a foundation for rational protein engineering, including:

    • Creation of chimeric proteins combining domains from different species

    • Development of sensors based on conformational changes in cytochrome b

    • Design of modified proteins with enhanced stability or altered properties for biotechnological applications

  • Interaction Screening Systems: Based on the precedent of studying PLIβ-cytochrome c interactions , researchers can develop:

    • High-throughput screening assays for molecules that modulate cytochrome b interactions

    • Yeast two-hybrid or related systems specifically optimized for mitochondrial membrane proteins

    • Fluorescence-based interaction assays for real-time monitoring of binding events

  • Model Systems for Mitochondrial Disease: The recombinant protein can be used to establish:

    • Cell culture models expressing wild-type or mutant forms of the protein

    • In vitro systems for testing how specific mutations affect electron transfer

    • Platforms for screening potential therapeutic compounds that might restore function to mutant cytochrome b

  • Educational and Training Tools: The well-characterized recombinant protein serves as an excellent model for:

    • Teaching advanced biochemical techniques in laboratory courses

    • Training new researchers in membrane protein handling and analysis

    • Demonstrating evolutionary principles through comparative analysis

The availability of recombinant expression protocols similar to those used for related proteins makes these experimental systems accessible to researchers with standard molecular biology capabilities, though specialized equipment may be required for certain applications such as SPR analysis or advanced structural studies.

How does Gloydius blomhoffii Cytochrome b compare structurally with cytochrome b proteins from other species?

The detailed comparative analysis of cytochrome b structures across species provides valuable insights into both the functional constraints on this essential protein and the evolutionary processes that have shaped its structure in different lineages.

What insights can be gained from studying the interactions between Gloydius blomhoffii proteins and cytochrome molecules?

The study of interactions between Gloydius blomhoffii proteins and cytochrome molecules reveals sophisticated biochemical networks with implications for understanding both snake-specific adaptations and broader principles of protein-protein interactions:

  • Cross-Species Binding Specificities: Research on related snake species has shown interesting patterns of cytochrome binding. For example, Gloydius brevicaudus PLIβ (phospholipase A2 inhibitory protein) binds various cytochrome c molecules with different affinities:

    • Horse cytochrome c: KD = 1.05 × 10^-10 M

    • Snake cytochrome c: KD = 2.37 × 10^-12 M

    • Yeast cytochrome c: KD = 1.67 × 10^-6 M

    These differential binding affinities suggest evolutionary adaptation of binding interfaces.

  • Evolutionary Relationship with Human Proteins: Human leucine-rich α2-glycoprotein (LRG), which shares 33% sequence identity with snake PLIβ, also exhibits cytochrome c binding, but with different specificity patterns:

    • Horse cytochrome c: KD = 1.58 × 10^-13 M

    • Snake cytochrome c: KD = 1.65 × 10^-10 M

    • No detectable binding to yeast cytochrome c

    This suggests convergent or divergent evolution of cytochrome-binding proteins across species.

  • Functional Significance of Interactions: These interactions appear to have important physiological roles:

    • "Autologous Cyt c is an endogeneous ligand for LRG and PLIβ"

    • These serum proteins may "neutralize the autologous Cyt c released from the dead cells"

    • Such interactions may represent ancient innate immunity mechanisms

  • Competitive Binding Dynamics: Studies have shown that PLIβ can bind both cytochrome c and phospholipase A2, with the binding of cytochrome c suppressing the PLA2 inhibitory activity . This suggests complex regulatory networks involving competitive binding.

  • Methodological Approaches: Surface plasmon resonance (SPR) analysis has proven effective for quantifying these interactions , providing a methodological framework for studying Gloydius blomhoffii protein interactions.

These findings offer significant insights into both the evolution of protein interaction networks and potential physiological mechanisms for managing cellular damage, with possible implications for understanding human cytochrome-related pathologies and developing novel therapeutic approaches.

How do mutations in cytochrome b genes across species inform our understanding of mitochondrial evolution?

Mutations in cytochrome b genes across species provide a unique window into mitochondrial evolution, offering insights into both natural selection processes and disease mechanisms:

  • Evolutionary Rate Patterns: Cytochrome b shows different patterns of evolutionary change across its structure:

    • Transmembrane regions evolve more slowly due to structural constraints

    • Surface-exposed loops evolve more rapidly

    • Functional sites involved in electron transport show extreme conservation

    These patterns reflect the balance between functional constraints and adaptive pressures.

  • Natural versus Pathogenic Mutations: Comparing natural sequence variations across species with pathogenic mutations in humans reveals:

    • Some positions tolerate variation across species but cause disease when mutated in humans

    • Other positions show strict conservation across all species, reflecting critical functional roles

    • The specific case of m.14864 T>C mutation in human MTCYB (changing a conserved cysteine to arginine) illustrates how mutations at highly conserved positions often lead to disease

  • Disease-Associated Mutation Distribution: Human MTCYB mutations have been associated with:

    • Isolated mitochondrial myopathy

    • Exercise intolerance

    • Multisystem disorders

    • Parkinsonism/MELAS overlap syndrome

    The distribution of these mutations provides insight into functionally critical regions.

  • Heteroplasmy Effects: The observation that pathogenic mutations like m.14864 T>C can be "heteroplasmic in muscle, blood, fibroblasts, and urinary sediment from the patient but absent in accessible tissues from her asymptomatic mother" illustrates the complex dynamics of mitochondrial genetics.

  • Evolutionary Medicine Implications: The evolutionary analysis of cytochrome b mutations informs:

    • Prediction of pathogenicity for novel variants

    • Understanding of tissue-specific effects

    • Development of potential therapeutic approaches based on evolutionarily conserved mechanisms

This comparative analysis of cytochrome b mutations across species represents a powerful approach to understanding both the fundamental principles of molecular evolution and the pathogenic mechanisms underlying mitochondrial diseases, demonstrating the value of studying proteins like Gloydius blomhoffii Cytochrome b in a broader evolutionary context.

What are the current methodological challenges in studying Gloydius blomhoffii Cytochrome b structure-function relationships?

Despite advances in protein science, several significant methodological challenges remain in elucidating the complete structure-function relationships of Gloydius blomhoffii Cytochrome b:

  • Membrane Protein Expression and Purification:

    • Obtaining sufficient quantities of properly folded membrane proteins remains challenging

    • Expression often results in inclusion bodies requiring complex refolding protocols

    • Native lipid environment is difficult to replicate in vitro

    • Current approaches using E. coli systems may not maintain post-translational modifications

  • Structural Analysis Limitations:

    • While computational models show high confidence (pLDDT score: 91.99) , experimental validation remains crucial

    • X-ray crystallography of membrane proteins requires specialized techniques for crystallization

    • Cryo-EM typically requires larger complexes for optimal resolution

    • Dynamic aspects of the protein's function may not be captured in static structures

  • Functional Assay Development:

    • Reconstituting electron transport activity requires complex multi-protein systems

    • Measuring proton translocation necessitates specialized membrane systems

    • Distinguishing direct and indirect effects of mutations is technically challenging

    • Species-specific functional adaptations may not be evident in standard assays

  • Protein-Protein Interaction Characterization:

    • Weak or transient interactions may be missed by conventional techniques

    • Membrane environment significantly influences interaction dynamics

    • Confirming physiological relevance of observed interactions requires multiple approaches

    • Surface plasmon resonance techniques used for related proteins may require optimization

  • Translational Research Barriers:

    • Connecting snake cytochrome b findings to human disease mechanisms requires careful validation

    • Species differences may limit direct application of findings

    • Establishing relevant disease models that incorporate findings from snake proteins is complex

    • Intellectual property considerations may limit commercial development of research tools

Addressing these challenges requires interdisciplinary approaches combining molecular biology, biochemistry, structural biology, biophysics, and computational modeling. Development of new methodologies specifically adapted for membrane proteins like cytochrome b would significantly advance this field.

How might research on Gloydius blomhoffii Cytochrome b contribute to novel therapeutic approaches?

Research on Gloydius blomhoffii Cytochrome b has several potential pathways to therapeutic innovation, particularly for mitochondrial disorders and related conditions:

  • Drug Target Identification and Validation:

    • Comparative analysis between snake and human cytochrome b can reveal conserved functional sites suitable for targeted therapeutics

    • Structural differences may identify snake-specific features that could be exploited for anti-venom therapeutics

    • High-resolution structural data (building on the AlphaFold model with pLDDT score: 91.99) can guide rational drug design

  • Biomarker Development:

    • Understanding cytochrome b mutations and their effects could lead to biomarkers for diagnosing and monitoring mitochondrial diseases

    • Specific antibodies developed against recombinant cytochrome b could be adapted for diagnostic applications

    • Protein-protein interaction profiles may serve as functional biomarkers

  • Protein Replacement Strategies:

    • Insights from snake cytochrome b could inform the design of modified human cytochrome b variants with enhanced stability or function

    • Techniques for producing recombinant cytochrome b could be optimized for therapeutic protein production

    • Delivery systems targeting mitochondria could be developed based on fundamental research

  • Gene Therapy Approaches:

    • Understanding critical functional domains through comparative analysis can guide gene editing strategies

    • Heteroplasmy management approaches could be developed based on insights from mutation studies

    • Alternative splicing or RNA editing strategies might be informed by evolutionary analysis

  • Novel Biochemical Pathways:

    • The discovery that proteins like PLIβ bind cytochrome c and potentially neutralize it when released from dead cells suggests new approaches to managing cellular damage

    • These pathways might be exploited for conditions involving mitochondrial dysfunction and cell death

    • The extraordinary binding affinity observed (e.g., KD = 1.58 × 10^-13 M for human LRG binding to horse cytochrome c) suggests potential for highly specific therapeutic interactions

  • Diagnostic Applications:

    • Antibodies against recombinant proteins developed using techniques similar to those for related proteins could improve diagnosis of mitochondrial disorders

    • Better understanding of mutation effects could enhance genetic counseling for mitochondrial diseases

    • Functional assays based on cytochrome b research could assess mitochondrial health in patients

These therapeutic possibilities require substantial translational research but highlight the potential long-term clinical impact of basic research on Gloydius blomhoffii Cytochrome b.

What emerging technologies might advance Gloydius blomhoffii Cytochrome b research in the next decade?

Several cutting-edge technologies are poised to transform research on Gloydius blomhoffii Cytochrome b and similar proteins in the coming decade:

  • Advanced Structural Biology Techniques:

    • Cryo-electron tomography (cryo-ET) will enable visualization of cytochrome b in its native membrane environment

    • Integrative structural biology approaches combining multiple data sources will refine the computational models currently available

    • Serial femtosecond crystallography using X-ray free-electron lasers (XFELs) may capture dynamic states of the protein during function

    • Microcrystal electron diffraction (MicroED) could determine structures from nanoscale crystals of membrane proteins

  • Single-Molecule Techniques:

    • Single-molecule FRET studies will reveal conformational changes during electron transport

    • High-speed atomic force microscopy (HS-AFM) will visualize structural dynamics in near-native conditions

    • Nanopore technologies may enable new approaches to studying membrane protein insertion and folding

    • Single-molecule force spectroscopy will measure interaction strengths directly

  • Advanced Protein Engineering:

    • De novo protein design approaches may create synthetic cytochrome variants with enhanced properties

    • Directed evolution in cell-free systems could optimize protein function for specific applications

    • Non-canonical amino acid incorporation will enable site-specific probes for structure-function studies

    • Computational protein design algorithms will predict stabilizing mutations for improved recombinant expression

  • Artificial Intelligence and Machine Learning:

    • Beyond AlphaFold-like prediction , ML will predict functional effects of mutations

    • Automated literature mining will integrate knowledge across species and studies

    • Virtual screening will identify potential interaction partners and modulators

    • Simulation technologies will model electron transport dynamics at unprecedented scale

  • Advanced Cellular Models:

    • Organoid technologies incorporating engineered mitochondria will test cytochrome b variants

    • CRISPR-based mitochondrial genome editing will create precise cellular models

    • Patient-derived iPSCs with engineered mitochondria will provide personalized disease models

    • Tissue-on-chip technologies will assess tissue-specific effects of cytochrome b variations

  • Systems Biology Integration:

    • Multi-omics approaches will place cytochrome b in broader metabolic contexts

    • Quantitative models of electron transport incorporating snake-specific parameters

    • Comparative mitochondrial interactomics across species

    • Evolutionary systems biology approaches linking sequence, structure, and function

These emerging technologies, particularly when applied in combination, promise to resolve current methodological challenges and open new avenues for understanding both the basic biology of Gloydius blomhoffii Cytochrome b and its potential applications in medicine and biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.