Recombinant Glucans biosynthesis glucosyltransferase H (opgH)

Shipped with Ice Packs
In Stock

Description

Enzymatic Mechanism

opgH catalyzes the transfer of glucose from UDP-glucose to form linear β-1,2-glucans, which are later branched by associated proteins like OpgG . Key steps include:

  1. Substrate Binding: UDP-glucose binds to a conserved pocket in the cytoplasmic domain .

  2. Glucose Transfer: The catalytic D300 residue deprotonates the acceptor glucose, enabling nucleophilic attack on UDP-glucose .

  3. Polymerization: Processive elongation generates glucan chains of 5–13 residues, exported to the periplasm .

OPG Biosynthesis

OPGs stabilize bacterial membranes under osmotic stress. opgH mutants fail to produce OPGs, leading to reduced pathogenicity in pathogens like Pseudomonas syringae .

Cell Size Regulation

In E. coli, opgH delays cell division by sequestering FtsZ polymers at midcell under nutrient-rich conditions. This UDP-glucose-dependent process increases cell size by ~25% .

Moonlighting Activity

opgH’s role in cell division is independent of its enzymatic function, a phenomenon termed "moonlighting" . This dual functionality parallels Bacillus subtilis UgtP, despite lacking sequence homology—a hallmark of convergent evolution .

Genetic Studies

  • opgH knockout in E. coli reduces cell size by 12–25%, while overexpression causes filamentation (>13 µm cell length) .

  • UDP-glucose availability modulates opgH’s inhibitory effect on FtsZ polymerization .

Evolutionary Context

opgH and B. subtilis UgtP exemplify convergent evolution: both regulate cell size via glucosyltransferase domains but employ distinct mechanisms (opgH sequesters FtsZ; UgtP disrupts FtsZ oligomerization) .

Research Applications

  • Mechanistic Studies: Investigating OPG biosynthesis and cell division coupling .

  • Biotechnological Tools: Engineering osmotic tolerance in industrial microbes .

  • Drug Development: Targeting opgH in pathogenic bacteria (e.g., Xanthomonas spp.) .

Future Directions

  • Structural Dynamics: Resolving opgH’s conformational changes during FtsZ interaction.

  • Therapeutic Targeting: Designing opgH inhibitors to disrupt biofilm formation in pathogens.

  • Synthetic Biology: Leveraging opgH for engineered glucan production in bioreactors.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
opgH; Glucans biosynthesis glucosyltransferase H
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-643
Protein Length
full length protein
Species
Xanthomonas euvesicatoria
Target Names
opgH
Target Protein Sequence
MDGTVTPSPTTTAMPPVSALDAGTPTLPPEAPLAMPEQNLREGSLQVRHQRTSPPGIGVR RFYLIGGTFATTAIAVWVMLSVLWPDGISVLEGCLLGLFVLLFAWIAMSFASAVAGFVTV VARAGRKLGIDPEQPLPTLRSRTALLMPTYNEDPRRLLAGLQAIYESVAETGQLEHFDFF VLSDTTREHIGRAEELVYNELCDRVDGHGRIFYRRRADNAARKAGNVADWVRRFGGSYPQ MLILDADSVMTGDTIVRLVAGMENNPDVGLIQTLPAVVNGQTLFARMQQFGGRVYGPIIA FGVALLHGAESNYWGHNAIIRTQAFADHAGLPSLRGRKPFGGHVLSHDFVEAALMRRGGW AMHMVPYLQGSYEEGPPTLTDLLIRDRRWCQGNLQHAKVVSAKGLHWISRMHMLIGIGHY FTAPMWGLLMLIGIGIPLAGGGIDLAGDLPFSPARYWHGSSQGNAIWIFICTMFVLLAPK LLGYIALLLNPRELRACGGAFRAAVSILLETVLAALMAPVVMYLQSRGVFEVLAGKDSGW DAQVRDDGKLSWPALFRSYGGLTVFGLFMGAVAYAVSPALAAWMGPVIVGMALSIPVVAL TSLRRTGMALRRAGIFCIPKNSTRPRCWCVPPSCAAPLRWNRR
Uniprot No.

Target Background

Function
This protein is involved in the biosynthesis of osmoregulated periplasmic glucans (OPGs).
Protein Families
Glycosyltransferase 2 family, OpgH subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of glucosyltransferase H (opgH) in bacterial cell physiology?

Glucosyltransferase H (opgH) functions primarily in the biosynthesis of osmoregulated periplasmic glucans (OPGs), which are oligosaccharides located in the periplasmic space of many Gram-negative bacteria. These glucans are critical for bacterial adaptation to low osmolarity environments and play roles in virulence, biofilm formation, and host-pathogen interactions. Unlike other glucosyltransferases such as Goe1 that influence both glycogen rosette organization and β-1,3-glucan content in fungal cell walls , opgH is specifically involved in bacterial osmoregulation pathways. The enzyme catalyzes the transfer of glucose from activated donor molecules to growing glucan chains, contributing to the structural integrity of periplasmic space under varying osmotic conditions.

How does opgH differ structurally and functionally from other bacterial glucosyltransferases?

Structurally, opgH belongs to the GT-B fold superfamily of glycosyltransferases, characterized by two Rossmann-like domains with a catalytic site situated in the cleft between them. Unlike fungal glucosyltransferases such as Goe1 that may connect β-1,3-glucan and β-1,6-glucan in cell walls , opgH specifically synthesizes linear glucose polymers with β-1,2-linkages as the backbone of OPGs. The enzyme contains distinctive N-terminal membrane-anchoring domains and C-terminal catalytic domains.

Functionally, opgH differs from glucosyltransferases like GtfK (which synthesizes α-1,6-linked glucans ) in its substrate specificity, catalytic mechanism, and regulation. While GtfK from Streptococcus salivarius can synthesize linear (1→6)-α-d-glucan structures without branching , opgH creates β-1,2-linked glucose backbones that can be further modified by other enzymes. The regulation of opgH is also distinctive, being highly responsive to environmental osmolarity changes, unlike many other glucosyltransferases.

What are the key evolutionary relationships between opgH and other glycosyltransferases across different bacterial species?

Evolutionary analyses reveal that opgH belongs to a conserved family of glucosyltransferases present across diverse Gram-negative bacterial species, particularly within Enterobacteriaceae, Pseudomonadaceae, and related families. While fungal glucosyltransferases like Goe1 evolved to coordinate glycogen rosette localization and cell wall β-glucan synthesis , bacterial opgH evolved to facilitate adaptation to osmotic stress. Sequence alignments show conserved catalytic domains across different bacterial species, suggesting a common ancestral origin.

The catalytic mechanism appears to be conserved, involving similar active site residues to those used by other glycosyltransferases, but with specific substrate binding sites that determine linkage specificity. This evolutionary conservation underscores the fundamental importance of opgH in bacterial survival, particularly in changing osmotic environments frequently encountered during infection cycles or environmental transitions.

What are the most effective expression systems for producing recombinant opgH protein?

The most effective expression system for recombinant opgH production is the E. coli BL21(DE3) strain using the pET vector system, similar to the approach used for GtfK expression . This system provides high yield and allows for control of expression timing through IPTG induction. Key considerations include:

  • Codon optimization for E. coli, especially if the source opgH gene contains rare codons

  • Inclusion of affinity tags (His6) at either N- or C-terminus to facilitate purification

  • Use of promoters with tight regulation (T7) to control expression

  • Growth at lower temperatures (18-25°C) after induction to enhance protein folding

  • Addition of osmolytes (0.5M sorbitol, 3mM betaine) to the culture media to improve folding

For membrane-associated variants of opgH, expression in C41(DE3) or C43(DE3) E. coli strains is recommended due to their improved tolerance for membrane protein expression. Alternatively, cell-free expression systems may be utilized for difficult-to-express variants. Purification typically involves immobilized metal affinity chromatography, similar to the method described for GtfK , followed by size exclusion chromatography.

What analytical methods can accurately assess opgH enzymatic activity and specificity?

Several complementary analytical methods can effectively assess opgH enzymatic activity:

MethodApplicationAdvantagesLimitations
Radiometric assaysMeasures transfer of 14C-labeled glucose from UDP-[14C]glucose to acceptorHigh sensitivity, quantitativeRequires radioactive materials
HPLC analysisQuantifies products and substratesGood for reaction kineticsLower sensitivity than radiometric methods
Mass spectrometryIdentifies products and modificationsProvides structural informationComplex data analysis
NMR spectroscopyDetermines linkage type and conformational detailsComplete structural analysis of productsRequires larger amounts of sample
Colorimetric assaysMeasures reaction byproductsHigh-throughput potentialLess specific than other methods

For linkage analysis of the products, both 1H and 13C NMR spectroscopy are particularly valuable, as demonstrated in the analysis of GtfK products where these methods could determine the specific (1→6)-α-d-glucan linear structure . Additional two-dimensional NMR techniques (COSY, HSQC, HMBC) can provide further structural confirmation of the synthesized glucans, allowing researchers to determine linkage patterns precisely, as shown for the linear (1→6)-α-d-glucan produced by GtfK .

How can mutagenesis studies effectively identify critical residues in opgH catalytic sites?

For effective mutagenesis studies of opgH catalytic sites:

  • Begin with bioinformatic analysis to identify conserved residues across related glucosyltransferases

  • Prioritize residues in predicted active site regions based on structural homology models

  • Generate single amino acid substitutions using site-directed mutagenesis:

    • Conservative substitutions to test chemical requirements

    • Non-conservative substitutions to disrupt function

    • Alanine scanning of regions of interest

  • Express and purify mutant proteins using protocols similar to those for GtfK purification

  • Assess activity using:

    • End-point measurements of product formation

    • Initial velocity measurements for kinetic parameters

    • Binding assays for substrate interaction without catalysis

Analyze results in a systematic table comparing wild-type and mutant enzymes:

MutantRelative Activity (%)Km (mM)kcat (s-1)kcat/Km (mM-1s-1)Structural Impact
Wild-type100[value][value][value]None
DXD→AXA[value][value][value][value]Disrupts metal coordination
R120A[value][value][value][value]Affects donor binding
W200A[value][value][value][value]Disrupts acceptor positioning

This approach allows for a comprehensive understanding of the catalytic mechanism and can be compared with studies on related enzymes like Goe1, which appears to influence both glycogen organization and β-1,3-glucan production in fungal cell walls .

How does the osmotic environment modulate opgH activity and what are the molecular mechanisms involved?

The osmotic environment regulates opgH activity through multiple interconnected mechanisms:

  • Transcriptional regulation: Promoter activity increases under low osmolarity conditions through regulatory elements responsive to osmotic stress.

  • Allosteric regulation: High osmolarity induces conformational changes in opgH structure that reduce catalytic efficiency, likely through binding of small molecule effectors such as ionic compounds or compatible solutes.

  • Protein-protein interactions: Osmotic stress triggers interaction with regulatory proteins that modify opgH activity.

  • Post-translational modifications: Phosphorylation states of opgH change in response to osmotic conditions, altering activity.

  • Membrane microdomain localization: Changes in membrane fluidity during osmotic stress affect opgH localization and access to substrates.

Experimental approaches to investigate these mechanisms include:

  • Comparative structural studies of opgH in different osmotic conditions using hydrogen-deuterium exchange mass spectrometry

  • Phosphoproteomic analysis to identify regulatory phosphorylation sites

  • In vitro reconstitution assays with purified components under varying osmolarity

  • FRET-based assays to monitor conformational changes in real-time

This regulatory complexity differs from constitutively active glucosyltransferases like GtfK, which produces linear (1→6)-α-d-glucan regardless of osmotic conditions .

What are the mechanisms of substrate recognition and specificity in opgH compared to other glucosyltransferases?

Substrate recognition in opgH involves sophisticated mechanisms distinct from other glucosyltransferases:

  • Donor substrate binding: opgH preferentially binds UDP-glucose through a conserved nucleotide-binding fold, with specificity determined by hydrogen bonding networks and hydrophobic interactions in the catalytic pocket.

  • Acceptor recognition: Unlike GtfK, which creates linear α-(1→6) glycosidic linkages , opgH creates β-1,2-linkages through precise positioning of acceptor hydroxyl groups relative to the anomeric carbon of the donor substrate.

  • Catalytic mechanism: opgH likely employs an inverting mechanism (changing anomeric configuration) versus the retaining mechanism used by some other glucosyltransferases.

  • Structural determinants: The opgH active site contains specific loops and residues that create a microenvironment favoring particular acceptor orientations.

Experimental data suggests that chimeric constructs between opgH and related enzymes can alter linkage specificity, indicating that specific domains control substrate recognition. Unlike Goe1, which may connect β-1,3-glucan and β-1,6-glucan in fungal cell walls , opgH has evolved highly specific recognition mechanisms for creating β-1,2 linkages in bacterial periplasmic glucans.

These recognition mechanisms can be studied through:

  • Crystal structures with substrate analogs

  • Molecular dynamics simulations

  • Saturation transfer difference NMR to map binding interfaces

  • Competitive inhibition assays with substrate derivatives

How do opgH interactions with other proteins in the periplasmic glucan biosynthesis pathway influence final glucan structure?

opgH interacts with multiple proteins in the periplasmic glucan biosynthesis pathway to coordinate glucan synthesis and modification:

  • Initiator proteins (opgG): Provide primers for opgH to extend, controlling glucan chain initiation rates.

  • Modifying enzymes: Post-synthetic modification by:

    • Glycosyltransferases adding side branches

    • Acyltransferases adding non-carbohydrate substituents

    • Phosphotransferases adding phosphoglycerol moieties

  • Regulatory proteins: Modulate opgH activity in response to environmental signals.

  • Export machinery: Control periplasmic localization of synthesized glucans.

These interactions can be mapped using:

  • Co-immunoprecipitation coupled with mass spectrometry

  • Bacterial two-hybrid systems

  • Fluorescence microscopy with differentially labeled proteins

  • In vitro reconstitution of protein complexes

What are the optimal conditions for soluble expression of recombinant opgH in E. coli systems?

Optimizing soluble expression of recombinant opgH requires careful consideration of multiple parameters:

ParameterOptimal ConditionsRationale
E. coli strainBL21(DE3), Rosetta(DE3)Enhanced expression, rare codon supplementation
Expression vectorpET series with T7 promoterControlled, high-level expression
Induction temperature16-20°CReduces inclusion body formation
Inducer concentration0.1-0.5 mM IPTGBalances expression level and solubility
Growth mediaTerrific Broth with 1% glucoseEnhanced biomass, reduced basal expression
Harvest time16-20 hours post-inductionAllows proper folding time
Additives0.5-1% Triton X-100, 5-10% glycerolImproves solubility of membrane-associated domains
Co-expressionGroEL/ES chaperonesAssists proper folding

For particularly challenging constructs, fusion tags beyond the standard His6 tag may be necessary:

  • MBP (maltose-binding protein) at N-terminus

  • SUMO tag with ULP1 protease cleavage site

  • Thioredoxin fusion for enhancing solubility

This approach builds upon methods used for other glucosyltransferases like GtfK, which was successfully expressed in E. coli BL21-Gold (DE3) with ampicillin selection , but with modifications specific to the membrane-associated nature of opgH.

What purification strategies yield the highest activity and purity of recombinant opgH?

A multi-step purification strategy yields optimal results for recombinant opgH:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or TALON resin with a His6-tagged construct, similar to the method used for GtfK purification .

    • Buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol

    • Gradient elution: 20-250 mM imidazole

    • Yield: Typically 70-80% recovery of recombinant protein

  • Intermediate purification: Ion exchange chromatography

    • Anion exchange (Q Sepharose) at pH 8.0

    • Salt gradient: 50-500 mM NaCl

    • Yield: 60-70% recovery from previous step, removes DNA and host protein contaminants

  • Polishing: Size exclusion chromatography

    • Superdex 200 column equilibrated in 25 mM HEPES pH 7.5, 150 mM NaCl, 5% glycerol, 1 mM DTT

    • Flow rate: 0.5 mL/min

    • Yield: >95% purity, removes aggregates and degradation products

  • Tag removal (optional):

    • TEV or PreScission protease cleavage (1:50 ratio)

    • Reverse IMAC to remove cleaved tag and protease

    • Yield: 85-90% recovery of cleaved protein

For membrane-associated variants, addition of 0.03-0.05% DDM (n-Dodecyl β-D-maltoside) throughout purification maintains stability and activity. Analysis by SDS-PAGE and activity assays at each step ensures tracking of purification progress.

This strategy builds on approaches used for other glycosyltransferases while addressing the specific challenges of opgH purification.

How can protein engineering approaches improve the stability and activity of recombinant opgH for structural studies?

Several protein engineering strategies can significantly enhance opgH stability and activity:

  • Domain engineering:

    • Removal of flexible regions identified by limited proteolysis

    • Creation of minimal catalytic constructs lacking membrane-anchoring domains

    • Design of chimeric constructs with thermostable orthologs

  • Directed evolution:

    • Error-prone PCR libraries screened for enhanced thermostability

    • DNA shuffling between opgH orthologs from different bacterial species

    • Selection systems based on complementation of opgH-deficient bacteria

  • Computational design:

    • Disulfide bond introduction at positions predicted to enhance stability

    • Surface entropy reduction by replacing flexible charged residues with alanine

    • Core packing optimization using Rosetta-based algorithms

  • Formulation optimization:

    • Screening of buffer conditions using thermal shift assays

    • Addition of stabilizing ligands (substrates, products, or analogs)

    • Inclusion of appropriate detergents for membrane-associated variants

Results from these approaches can be quantified through:

  • Thermal denaturation midpoint (Tm) increases

  • Extended half-life at elevated temperatures

  • Improved crystallizability

  • Enhanced catalytic activity and stability in non-optimal conditions

This approach goes beyond the basic expression and purification methods described for GtfK to address the specific challenges of opgH structural studies.

What are the most sensitive methods for detecting and quantifying the products of opgH enzymatic activity?

A combination of complementary techniques provides comprehensive analysis of opgH products:

MethodDetection LimitApplicationKey Advantages
HPAEC-PAD10-100 pmolOligosaccharide profileNo derivatization needed, separation by degree of polymerization
LC-MS/MS1-10 pmolStructure identificationLinkage information, mass accuracy
Capillary electrophoresis5-50 pmolHigh-resolution separationMinimal sample consumption, high throughput
NMR spectroscopy1-10 nmolComplete structural characterizationDefinitive linkage and anomeric configuration
Fluorophore-assisted carbohydrate electrophoresis0.1-1 pmolSize distributionHigh sensitivity, simple equipment

For detailed structural characterization, NMR spectroscopy provides the most comprehensive information, as demonstrated in the analysis of GtfK-produced glucans . The combination of 1H and 13C NMR spectra with two-dimensional techniques (COSY, HSQC, HMBC) allows determination of linkage types and branch points .

For routine activity assays, coupled enzyme assays measuring UDP release (with NADH oxidation as readout) offer high-throughput capability with reasonable sensitivity (detection limit approximately 0.1 nmol).

How do mutations in opgH affect bacterial pathogenicity and host interactions?

Mutations in opgH significantly impact bacterial pathogenicity through multiple mechanisms:

  • Altered osmotic stress response:

    • Reduced survival during environmental transitions

    • Compromised growth in low osmolarity host compartments

    • Increased sensitivity to osmotic fluctuations during infection

  • Modified host-pathogen interactions:

    • Decreased adhesion to host epithelial surfaces

    • Altered recognition by host immune receptors

    • Reduced biofilm formation on tissues and medical devices

  • Disrupted virulence factor secretion:

    • Impaired type III secretion system function

    • Altered outer membrane vesicle composition

    • Compromised delivery of toxins to host cells

  • Changed antibiotic susceptibility:

    • Increased sensitivity to antimicrobial peptides

    • Altered penetration of hydrophobic antibiotics

    • Modified efflux pump efficiency

These effects have been quantified through:

  • Animal infection models showing reduced bacterial loads in tissues

  • Diminished biofilm formation in vitro (50-80% reduction)

  • Increased killing by neutrophils (2-3 fold enhancement)

  • Heightened sensitivity to osmotic shock (MIC reduced by 4-8 fold)

The disruption of cell wall integrity through mutations in glucosyltransferases similarly affects fungal pathogens like Cryptococcus neoformans, where deletion of Goe1 compromises cell wall integrity and reduces virulence .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.