Recombinant Gluconacetobacter diazotrophicus ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Introduction to ATP Synthase Subunit a (atpB)

The ATP synthase subunit a (atpB) is a critical component of the F₀ sector in bacterial ATP synthases, facilitating proton translocation and ATP synthesis. In Gluconacetobacter diazotrophicus, a nitrogen-fixing endophyte, this protein plays a central role in energy metabolism. Recombinant production of atpB has enabled detailed biochemical and structural studies, leveraging its full-length sequence (249 amino acids) and N-terminal His-tag for purification .

Recombinant Production and Purification

Recombinant atpB is expressed in E. coli under optimized conditions, followed by affinity chromatography using nickel or cobalt resin due to the His-tag . Post-purification steps include lyophilization in Tris/PBS-based buffer with 6% trehalose to enhance stability .

Key Applications:

  • SDS-PAGE: Used to verify purity and confirm the expected molecular weight (~28 kDa) .

  • Biochemical Assays: Probing proton translocation mechanisms in ATP synthase complexes.

  • Structural Studies: Crystallization or cryo-EM for resolving subunit interactions.

Role in ATP Synthesis

atpB forms part of the F₀F₁ ATP synthase, which couples proton motive force to ATP synthesis. In G. diazotrophicus, this system is essential for energy production, particularly under microaerobic conditions required for nitrogen fixation .

Genomic Context

The atpB gene resides in the core genome of G. diazotrophicus, shared across phylogenetically related bacteria. Its expression is tightly regulated to maintain cellular energy homeostasis .

Comparative Analysis of Recombinant Variants

Table 2: Comparison of Recombinant atpB Products

FeatureFull-Length (RFL22535GF) Partial (CSB-BP015070GEN1)
Length1–249 aaPartial
Purity>90%>85%
TagN-terminal His-tagTag type determined post-expression
ApplicationsStructural, functional studiesLimited to partial analysis

Full-length atpB is preferred for studying membrane topology and subunit interactions, while partial versions may serve niche applications .

Biotechnological and Agricultural Relevance

G. diazotrophicus is widely used as a biofertilizer due to its nitrogen-fixing capacity. The atpB protein’s study contributes to understanding energy metabolism in diazotrophs, potentially optimizing their performance in agricultural systems .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All protein orders are shipped with standard blue ice packs by default. If dry ice shipment is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please let us know, and we will prioritize developing the specified tag.
Synonyms
atpB; GDI1180; Gdia_1893; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5)
Target Names
atpB
Target Protein Sequence
MAAGSTIDALGQFELHPVLGGLGESLRFSQSPVMMIVASVLVLAFLYVGMRPAAIVPGRL QAAAEICYDFIHDMAVDTIGPEGRAFFPFIFTLFFFILAGNYLGLLPFSFAFTSHIAVTL ALALLVFVLAVIVSLKAQGPKFFAHFMPAGAPVALAPLLVPIEILSFLSRPVSLSIRLFA NMVAGHVMLEMFAAFTIMLAGLGLFGDVLAVGPVVINVALMALELLVGALQAYVFAILTC IYLREAVAH
Uniprot No.

Target Background

Function
As a key component of the proton channel, ATP synthase subunit a (atpB) plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of ATP synthase subunit a (atpB) in G. diazotrophicus metabolism?

ATP synthase subunit a (atpB) forms a critical component of the F0 portion of F1F0-ATP synthase in G. diazotrophicus, creating the proton channel through the membrane. This subunit plays an essential role in energy generation during both aerobic and microaerobic growth conditions. During diazotrophic growth, when G. diazotrophicus is fixing atmospheric nitrogen, efficient ATP production becomes particularly crucial as nitrogen fixation is an energy-intensive process. The proton gradient maintained across the membrane drives ATP synthesis, which powers numerous cellular processes including nitrogen fixation .

Unlike other subunits like atpH (ATP synthase subunit delta, GDI_0693), which has been documented to be downregulated under certain conditions like iron limitation, the regulation patterns of atpB may differ based on metabolic demands . ATP synthase complexes are fundamental to cellular bioenergetics in this organism, especially considering its unique lifestyle as both a nitrogen-fixing bacterium and an endophyte.

How does ATP synthase function differ during diazotrophic versus non-diazotrophic growth?

G. diazotrophicus demonstrates significant metabolic shifts when transitioning between diazotrophic (nitrogen-fixing) and non-diazotrophic growth conditions. During diazotrophic growth, which requires microaerobic conditions, the bacterium shows distinctive expression patterns in energy metabolism genes. The ATP synthase complex becomes particularly important as nitrogen fixation is highly ATP-dependent.

Transposon insertion sequencing (Tn-seq) studies have revealed that disruption of certain genes involved in energy metabolism affects the fitness of G. diazotrophicus differently under diazotrophic versus ammonium-supplemented conditions . While specific data on atpB expression patterns is limited, related ATP synthase components such as atpH show differential regulation patterns depending on growth conditions and environmental factors . This suggests that the ATP synthase complex, including atpB, undergoes regulatory changes to accommodate the high energy demands of nitrogen fixation.

What expression systems are most effective for producing recombinant G. diazotrophicus atpB?

Based on molecular cloning approaches used for other G. diazotrophicus proteins, several expression systems have proven effective for producing recombinant proteins from this organism:

Expression SystemAdvantagesLimitationsSuitable Applications
E. coli BL21(DE3)High yield, well-established protocolsPotential folding issues for membrane proteinsInitial screening, antibody production
E. coli C43(DE3)Specialized for membrane proteinsLower yield than standard BL21Functional studies of atpB
Homologous expression in G. diazotrophicusNative folding and processingComplex methodology, lower yieldsStructural and functional studies

For atpB expression specifically, E. coli C43(DE3) may be preferred due to its ability to handle membrane proteins better than standard strains. Cloning approaches similar to those used for other G. diazotrophicus genes can be adapted, such as the techniques employed for cloning the type II secretion system genes, where fragments were inserted into vectors like pUC8 and subsequently moved to broad-host-range vectors for functional complementation studies .

How does iron limitation affect atpB expression and ATP synthase complex formation in G. diazotrophicus?

Transcriptomic analyses of G. diazotrophicus under iron limitation have revealed significant impacts on energy metabolism genes. While specific data on atpB regulation is not directly reported in the search results, related components of energy metabolism pathways show distinct patterns. For instance, atpH (ATP synthase subunit delta, GDI_0693) is downregulated under iron limitation conditions .

Iron is an essential cofactor for many proteins involved in electron transport chains that generate the proton gradient necessary for ATP synthase function. Under iron-limited conditions, G. diazotrophicus appears to adjust its energy metabolism pathways, potentially affecting the assembly and function of the ATP synthase complex.

The transcriptional response includes differential regulation of genes involved in the TCA cycle and oxidative phosphorylation. For example, sucCD genes (GDI_2951; GDI_2952) involved in the TCA cycle are upregulated, while certain NADH-quinone oxidoreductase components (nuoI, GDI_3032; nuoK, GDI_3310) in the electron transport chain are downregulated . These adjustments in energy metabolism pathways likely reflect the bacterium's strategy to maintain energy production under iron-limited conditions, which would ultimately affect the functional context in which ATP synthase, including atpB, operates.

What methodologies are most effective for studying the structure-function relationship of recombinant atpB?

For comprehensive structure-function analysis of recombinant atpB from G. diazotrophicus, a multi-faceted approach is recommended:

  • Site-directed mutagenesis: Target conserved residues predicted to be involved in proton translocation or subunit interactions.

  • Cryo-electron microscopy (cryo-EM): For structural determination of the entire ATP synthase complex with atpB in its native membrane environment.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To examine conformational dynamics during the catalytic cycle.

  • Functional complementation studies: Similar to approaches used for other G. diazotrophicus genes, where mutant strains can be complemented with modified versions of atpB to assess functionality .

  • Biochemical assays for ATP synthesis activity: Using purified recombinant ATP synthase components incorporated into liposomes.

A particularly informative approach would be to generate transposon insertion mutants affecting atpB, similar to the Tn-seq methodology applied to study other G. diazotrophicus genes . This would allow assessment of the fitness effects of atpB disruption under various growth conditions, including diazotrophic versus non-diazotrophic conditions.

How does recombinant atpB contribute to acetic acid tolerance mechanisms in G. diazotrophicus?

While specific data on atpB's role in acetic acid tolerance in G. diazotrophicus is not directly provided in the search results, insights can be drawn from studies on related acetic acid bacteria. In Acetobacter pasteurianus, improved energy metabolism has been linked to enhanced acetic acid tolerance. Specifically, higher energy charge (EC) and intracellular ATP levels correlate with improved tolerance to acetic acid stress .

ATP-binding cassette transporters (ABC transporters) are key contributors to acetic acid tolerance, as they actively export acetic acid from the cell, a process that requires ATP. Enhanced ATP production capacity, potentially through optimized ATP synthase function, could therefore support improved acetic acid tolerance in G. diazotrophicus.

The connection between energy metabolism and stress tolerance is further supported by observations that strains with enhanced pyrroloquinoline quinone (PQQ) production display improved acetic acid tolerance, attributed to enhanced activity of the alcohol respiratory chain and increased ATP production . By extension, the atpB component of ATP synthase likely plays a crucial role in maintaining energy homeostasis under acetic acid stress conditions.

What are the gene expression patterns of atpB during different growth phases and how do they correlate with energy demands?

In related bacteria like Acetobacter pasteurianus, ATP levels and energy charge show distinct patterns during fermentation phases. During early growth phases (before 6 hours), energy metabolism relies primarily on glucose metabolism. As cells enter logarithmic growth (around 9 hours), the alcohol respiratory chain becomes the main energy-supplying pathway, with ATP levels increasing to support rapid growth .

The transition between growth phases involves significant metabolic shifts, with ATP production peaking during mid-logarithmic phase (21-33 hours) in A. pasteurianus . Given the importance of ATP synthase in energy generation, atpB expression would likely correlate with these energy demand patterns, potentially showing upregulation during periods of high metabolic activity.

For G. diazotrophicus specifically, the expression patterns would be further influenced by nitrogen fixation requirements under diazotrophic conditions, potentially showing different patterns compared to growth with available nitrogen sources .

How can I optimize purification protocols for recombinant G. diazotrophicus atpB?

Purifying recombinant atpB presents unique challenges due to its hydrophobic nature as a membrane protein. A recommended optimized protocol includes:

  • Expression system selection: Use E. coli C43(DE3) with a pET-based vector containing a 10x His-tag for affinity purification.

  • Growth conditions: Grow at 25°C after IPTG induction to enhance proper folding.

  • Membrane preparation:

    • Harvest cells and resuspend in buffer containing 50 mM Tris-HCl pH 8.0, 10% glycerol

    • Lyse cells using a cell disruptor or sonication

    • Remove cell debris by centrifugation at 10,000×g for 20 min

    • Collect membranes by ultracentrifugation at 150,000×g for 1 hour

  • Solubilization and purification:

    • Solubilize membranes in buffer containing 1-2% n-dodecyl β-D-maltoside (DDM)

    • Purify using nickel affinity chromatography with imidazole gradient elution

    • Apply size exclusion chromatography for final purification

  • Quality assessment:

    • SDS-PAGE analysis

    • Western blotting with anti-His antibodies

    • Mass spectrometry confirmation of protein identity

This approach draws on methodologies similar to those used for other membrane proteins from bacteria, adapted for the specific properties of G. diazotrophicus atpB.

What are effective strategies for investigating interactions between atpB and other ATP synthase subunits?

To investigate the protein-protein interactions between atpB and other ATP synthase subunits in G. diazotrophicus, several complementary approaches are recommended:

TechniqueInformation ProvidedAdvantagesLimitations
Co-immunoprecipitationDirect binding partnersWorks with endogenous proteinsRequires specific antibodies
Bacterial two-hybrid assayBinary interactionsSuitable for membrane proteinsMay yield false positives
Cross-linking coupled with mass spectrometryInteraction interfacesIdentifies specific contact residuesComplex data analysis
Blue native PAGENative complex assemblyMaintains native complexesLimited resolution of specific interactions
Förster resonance energy transfer (FRET)Dynamic interactions in vivoReal-time monitoring possibleRequires fluorescent protein fusions

For atpB specifically, cross-linking approaches would be particularly valuable for identifying interaction interfaces with other F0 subunits. Implementing these techniques would enable construction of a detailed interaction map of the ATP synthase complex in G. diazotrophicus, providing insights into how the function of this essential complex is optimized for the organism's unique metabolic requirements.

How can I assess the impact of atpB mutations on ATP synthesis efficiency and nitrogen fixation?

To comprehensively evaluate how atpB mutations affect ATP synthesis and subsequent nitrogen fixation in G. diazotrophicus, a multi-parameter assessment approach is recommended:

  • Generation of atpB variants:

    • Create a library of site-directed mutants targeting conserved residues

    • Develop a complementation system in an atpB-deficient strain

  • ATP synthesis measurement:

    • Direct measurement of ATP production using luciferase-based assays

    • Membrane potential analysis using fluorescent probes like TMRM or DiSC3(5)

    • Oxygen consumption rate determination using respirometry

  • Nitrogen fixation capacity assessment:

    • Acetylene reduction assay to quantify nitrogenase activity

    • 15N incorporation studies for direct measurement of nitrogen fixation

    • Growth curve analysis under diazotrophic conditions

  • Energy charge determination:

    • Measure ATP:ADP:AMP ratios as performed in acetic acid bacteria studies

    • Calculate energy charge using the formula: EC = (ATP + 0.5 ADP)/(ATP + ADP + AMP)

  • Fitness assessment under various conditions:

    • Competition assays between wild-type and mutant strains

    • Fitness measurement under stress conditions (acidity, oxygen limitation)

    • Long-term evolution experiments to assess compensatory mutations

This approach would provide comprehensive insights into how specific atpB mutations affect energy production and the downstream process of nitrogen fixation, potentially revealing critical structure-function relationships.

How do I interpret contradictory transcriptomic data regarding atpB expression under different conditions?

When faced with contradictory transcriptomic data regarding atpB expression, consider these analytical approaches:

  • Methodological differences assessment:

    • Compare RNA extraction methods, which can bias toward certain transcript types

    • Evaluate normalization strategies used in different studies

    • Consider sequencing depth and platform differences

  • Experimental condition variation analysis:

    • Create a detailed comparison table of growth conditions including:

      • Media composition (carbon sources, micronutrients)

      • Growth phase at sampling

      • Oxygen levels and environmental stressors

    • Minor variations in microaerobic conditions can significantly impact energy metabolism gene expression

  • Context of other energy metabolism genes:

    • Compare expression patterns with functionally related genes (other ATP synthase subunits)

    • Examine broader metabolic pathways (TCA cycle, electron transport)

    • Consider regulatory elements like iron-response elements or oxygen-sensing regulators

  • Validation experiments:

    • Perform RT-qPCR with carefully designed primers specific to atpB

    • Use reporter gene fusions to monitor promoter activity in vivo

    • Western blotting with specific antibodies to confirm protein-level changes

Conflicting data often reveals important regulatory nuances. For example, in G. diazotrophicus, iron limitation causes downregulation of certain ATP synthase components (like atpH) while simultaneously upregulating other energy metabolism genes (like sucCD) . This suggests complex regulatory networks that may respond differently to subtle experimental variations.

What bioinformatic approaches are most effective for analyzing atpB sequence conservation across Acetobacteraceae?

For comprehensive evolutionary analysis of atpB across the Acetobacteraceae family, including G. diazotrophicus, the following bioinformatic workflow is recommended:

  • Sequence retrieval and alignment:

    • Extract atpB sequences from complete Acetobacteraceae genomes

    • Use MAFFT or T-Coffee for initial alignment of transmembrane proteins

    • Refine alignments with HMMER profiles specific to ATP synthase subunit a

  • Conservation analysis:

    • Calculate site-specific evolutionary rates using Rate4Site

    • Map conservation scores onto predicted structural models

    • Identify functionally important conserved motifs

  • Phylogenetic reconstruction:

    • Select appropriate evolutionary models (e.g., LG+F+G for membrane proteins)

    • Construct maximum likelihood trees using IQ-TREE or RAxML

    • Assess tree reliability with ultrafast bootstrap approximation (1000 replicates)

  • Structural bioinformatics:

    • Generate homology models based on available ATP synthase structures

    • Map sequence conservation onto structural models

    • Predict functional impact of natural variations

  • Coevolutionary analysis:

    • Identify co-evolving residues using approaches like PSICOV or DCA

    • Correlate coevolving networks with known functional regions

    • Predict residue interactions important for proton translocation

This comprehensive approach would reveal not only the evolutionary history of atpB but also identify functionally critical regions that could be targeted in site-directed mutagenesis experiments to further understand structure-function relationships.

How can I differentiate between direct and indirect effects of atpB mutations on nitrogen fixation capacity?

Distinguishing direct from indirect effects of atpB mutations on nitrogen fixation requires a systems biology approach:

  • Metabolic flux analysis:

    • Measure intracellular ATP/ADP ratios and energy charge

    • Quantify metabolic intermediates of central carbon metabolism

    • Track isotope-labeled carbon flow through TCA cycle and related pathways

  • Temporal response analysis:

    • Monitor gene expression changes over time following atpB mutation

    • Establish causality through time-course experiments

    • Determine primary versus secondary responses

  • Genetic suppressor screening:

    • Identify second-site mutations that restore nitrogen fixation in atpB mutants

    • Characterize suppressor mechanism (compensatory or bypass)

    • Map genetic interactions network

  • Directed protein engineering:

    • Create specific mutations affecting proton translocation without disrupting assembly

    • Design mutations altering regulatory interactions rather than catalytic function

    • Develop partial loss-of-function variants with graded effects

  • Comparative analysis with related pathways:

    • Compare phenotypes with mutants in alternative ATP-generating pathways

    • Assess nitrogen fixation in mutants with comparable ATP deficits from different sources

    • Evaluate specificity of nitrogen fixation defects versus general growth defects

Direct effects would be characterized by immediate ATP limitation affecting nitrogenase activity, while indirect effects might manifest through altered gene expression patterns or metabolic adjustments over longer timeframes.

How can I overcome expression and solubility issues with recombinant G. diazotrophicus atpB?

Membrane proteins like atpB present significant challenges for recombinant expression. Here are targeted strategies to overcome common issues:

  • Low expression yield:

    • Optimize codon usage for expression host

    • Test different promoter strengths (trc, tac, T7)

    • Evaluate expression at lower temperatures (16-25°C)

    • Use specialized expression hosts like C41/C43(DE3) or Lemo21(DE3)

  • Inclusion body formation:

    • Reduce induction strength with lower IPTG concentrations (0.1-0.5 mM)

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

    • Incorporate solubility-enhancing fusion partners (MBP, SUMO)

    • Express as fragments to identify soluble domains

  • Inefficient membrane integration:

    • Use E. coli Rosetta-gami strains to enhance disulfide bond formation

    • Test cell-free expression systems with supplied membranes or nanodiscs

    • Try expression in native host using homologous recombination at genomic locus

  • Protein instability:

    • Screen various detergents beyond traditional DDM (LMNG, GDN, MNG-3)

    • Add stabilizing lipids during purification (cardiolipin, PE)

    • Incorporate chemical chaperones in lysis buffer (glycerol, sucrose)

    • Use GFP fusion to monitor folding and stability in real-time

  • Purification difficulties:

    • Test different affinity tags (His, Strep, FLAG) at both N and C termini

    • Implement mild solubilization conditions (styrene maleic acid lipid particles)

    • Use on-column detergent exchange during purification

    • Apply amphipol exchange for increased stability post-purification

These approaches can be systematically tested using small-scale expression trials before scaling up to larger cultures for functional studies.

What are the best approaches for resolving inconsistent ATP production measurements in G. diazotrophicus atpB studies?

Inconsistent ATP measurements in G. diazotrophicus studies can be methodologically challenging. Here's a systematic approach to address this issue:

  • Standardize sample preparation:

    • Harvest cells at identical growth phases (mid-log recommended)

    • Quench metabolism rapidly with cold perchloric acid or liquid nitrogen

    • Process all samples in parallel to minimize degradation

    • Maintain strict temperature control throughout extraction

  • Optimize extraction protocols:

    • Compare different extraction methods (TCA, perchloric acid, boiling)

    • Evaluate extraction efficiency with ATP recovery controls

    • Include phosphatase inhibitors to prevent ATP degradation

    • Consider subcellular fractionation for localized ATP pools

  • Refine measurement techniques:

    • Validate luciferase-based assays with internal standards

    • Implement LC-MS/MS for simultaneous quantification of ATP/ADP/AMP

    • Use 31P-NMR for non-destructive measurement when possible

    • Calculate energy charge (EC) for more complete bioenergetic assessment

  • Control for experimental variables:

    • Create a standardized growth protocol with precise control of:

      • Dissolved oxygen concentration (critical for G. diazotrophicus)

      • pH (affects proton gradient for ATP synthesis)

      • Growth phase sampling points (correlation with energy demands)

      • Media composition (carbon source affects metabolic pathways)

  • Statistical robustness:

    • Increase biological replicates (minimum n=5 recommended)

    • Perform power analysis to determine appropriate sample size

    • Apply appropriate statistical tests for data distribution type

    • Consider Bayesian approaches for handling variability

These methodological improvements, similar to approaches used in studies of energy charge in acetic acid bacteria , can significantly reduce variability and provide more consistent results when measuring ATP production in G. diazotrophicus atpB studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.