Recombinant Gluconacetobacter diazotrophicus ATP synthase subunit b (atpF)

Basic Research Questions

• What is Gluconacetobacter diazotrophicus and why is its ATP synthase of interest to researchers?

Gluconacetobacter diazotrophicus is an endophytic diazotrophic bacterium that has been extensively studied for its nitrogen-fixing capabilities and its ability to colonize a variety of host plants, particularly sugarcane. This gram-negative bacterium has become a model organism for understanding plant-microbe interactions and biological nitrogen fixation mechanisms. G. diazotrophicus has been characterized as strain ATCC 49037/DSM 5601/PAl5, with various gene sequences documented in databases .

The ATP synthase of G. diazotrophicus is of particular research interest because:

• It plays a crucial role in energy metabolism, which is essential for nitrogen fixation

• Understanding its structure-function relationship can provide insights into the bacterium's adaptation to endophytic lifestyle

• Its components may serve as potential targets for enhancing nitrogen fixation efficiency

• It represents a model for studying how energy production systems adapt to the unique environmental conditions inside plant tissues

Research has shown that G. diazotrophicus requires functional nitrogen fixation genes to effectively promote plant growth, suggesting a direct connection between its energy metabolism (supported by ATP synthase) and its beneficial properties as a biofertilizer .

• What are the structural characteristics of ATP synthase subunit b (atpF) in G. diazotrophicus?

The ATP synthase subunit b (atpF) in G. diazotrophicus is part of the F0 region of the ATP synthase complex, which is embedded in the bacterial membrane. Based on comparative analysis with other bacterial F-type ATP synthases, the subunit b has the following structural characteristics:

• It forms part of the peripheral stalk, connecting the membrane-embedded F0 region with the catalytic F1 region

• It typically contains a transmembrane domain at the N-terminus and an elongated α-helical domain that extends into the cytoplasm

• It functions as a stator, preventing rotation of the F1 region during ATP synthesis or hydrolysis

While the specific structure of G. diazotrophicus atpF has not been fully characterized in the available research, comparative analysis with other ATP synthase subunits from this organism (such as subunit c) suggests a membrane-spanning protein with defined functional domains. For context, the ATP synthase subunit c (atpE) from G. diazotrophicus strain ATCC 49037 consists of 74 amino acids with the sequence: MDIAAAAREIGAGIAVIALGVGIGLGNIFSTLVSSIARNPAARPHVFGLGMLGFALTEAVALYALLIAFLILFV .

• What are the most effective methods for cloning and expressing recombinant G. diazotrophicus ATP synthase subunit b?

The effective cloning and expression of recombinant G. diazotrophicus ATP synthase subunit b typically follows a systematic approach similar to that used for other membrane proteins. Based on successful protocols for similar proteins, the following methodology is recommended:

Cloning Strategy:

• Genomic DNA isolation from G. diazotrophicus strain ATCC 49037

• PCR amplification of the atpF gene using high-fidelity DNA polymerase

• Insertion into an appropriate expression vector (e.g., pKT230 shuttle vector, which has been successfully used for G. diazotrophicus recombinant protein expression)

• Confirmation of correct insertion by sequencing

Expression System Options:

Expression Protocol:

• Transform the recombinant plasmid into the chosen expression host

• Grow cultures in appropriate media (LGI medium has been used successfully for G. diazotrophicus)

• Induce protein expression with IPTG (for T7-based systems) or appropriate inducer

• Harvest cells by centrifugation (typically 4000-6000 × g for 5-20 minutes)

• Proceed with protein extraction and purification

This approach has been validated for other membrane proteins and recombinant proteins from G. diazotrophicus, with evidence showing successful expression while maintaining functionality, as demonstrated in studies with other recombinant G. diazotrophicus proteins .

• What purification techniques yield the highest purity and activity for recombinant G. diazotrophicus ATP synthase subunit b?

Purification of recombinant G. diazotrophicus ATP synthase subunit b requires specialized techniques due to its membrane protein nature. Based on successful protocols for similar proteins, a multi-step purification strategy is recommended:

Cell Lysis and Membrane Fraction Isolation:

• Resuspend cell pellets in lysis buffer (20 mM Tris-HCl pH 8.0 with 2% protease inhibitor cocktail)

• Add lysozyme (1 mg/mL) and incubate at 4°C for 1.5 hours

• Disrupt cells via sonication (50-75 W)

• Separate membrane fraction by ultracentrifugation (typically >100,000 × g)

Membrane Protein Solubilization:

• Solubilize membrane proteins using appropriate detergents (e.g., n-dodecyl-β-D-maltoside)

• Incubate with gentle agitation at 4°C for 1-2 hours

• Remove insoluble material by centrifugation

Purification Steps:

• Affinity Chromatography: If the recombinant protein contains an affinity tag (His-tag recommended), use nickel column affinity chromatography

• Size Exclusion Chromatography: Apply to Sephadex G-25 gel filtration column to remove small molecular contaminants

• Ion Exchange Chromatography: Use DEAE-sepharose fast flow ion exchange chromatography for final polishing

Activity Preservation Considerations:

• Maintain detergent concentration above critical micelle concentration throughout purification

• Include stabilizing agents such as glycerol (25-50%) in storage buffer

• Store purified protein at -20°C or -80°C for extended storage

This purification approach has yielded high purity (>95%) for similar bacterial membrane proteins while maintaining their functional activity .

• How can researchers verify the expression and functional integrity of recombinant G. diazotrophicus ATP synthase subunit b?

Verification of expression and functional integrity of recombinant G. diazotrophicus ATP synthase subunit b requires multiple complementary techniques:

Expression Verification:

• SDS-PAGE Analysis: Run samples on 12% polyacrylamide gels to visualize the target protein band

• Western Blotting: Use specific antibodies against ATP synthase subunit b or tagged epitopes

• Mass Spectrometry: Confirm protein identity through peptide mass fingerprinting or tandem MS

Structural Integrity Assessment:

• Circular Dichroism (CD) Spectroscopy: Evaluate secondary structure characteristics

• Fluorescence Spectroscopy: Assess tertiary structure integrity

• Size Exclusion Chromatography: Determine oligomeric state and aggregation profile

Functional Assays:

• ATPase Activity Assay: Measure ATP hydrolysis capability using colorimetric methods to detect released phosphate

• Reconstitution in Liposomes: Assess membrane insertion and proton translocation capability

• Binding Assays: Evaluate interaction with other ATP synthase subunits

Quantitative Assessment:

Previous research on recombinant ATP synthase subunits has demonstrated that immunoblotting techniques can effectively confirm expression, while ATPase activity assays have been successfully used to verify functional integrity, with typical specific activities around 53.2 nmol Pi released/min/mg protein at 37°C for ATP synthase components .

Advanced Research Questions

• What experimental design approaches are most suitable for optimizing recombinant G. diazotrophicus ATP synthase subunit b expression?

Optimizing the expression of recombinant G. diazotrophicus ATP synthase subunit b requires systematic experimental design approaches that address multiple variables. The following structured methodology is recommended:

Step 1: Define Variables and Relationships
First, identify independent variables (expression conditions) and dependent variables (protein yield, purity, activity) that need optimization:

Step 2: Formulate Testable Hypotheses
Develop specific hypotheses about how each variable affects expression:

• "Lower induction temperatures (16-25°C) will increase the proportion of correctly folded atpF compared to standard conditions (37°C)"

• "Co-expression with molecular chaperones will increase the yield of functional atpF"

Step 3: Design Experimental Treatments
Create a factorial experimental design varying key parameters:

• Temperature (16°C, 25°C, 30°C, 37°C)

• Inducer concentration (0.1 mM, 0.5 mM, 1.0 mM IPTG)

• Induction time (3h, 6h, overnight)

• Media formulation (LB, TB, autoinduction media)

Step 4: Group Assignment and Replication
Implement a between-subjects experimental design with appropriate replication:

• Minimum 3 biological replicates per condition

• Randomize experimental order to reduce systematic bias

Step 5: Measurement Plans
Establish quantitative methods for measuring outcomes:

• Standardized protein extraction protocol

• Consistent analysis methods (SDS-PAGE, Western blot, activity assays)

• Statistical analysis approach (ANOVA for multi-factorial analysis)

This systematic approach aligns with established experimental design principles and has been validated for optimizing expression of challenging membrane proteins. For G. diazotrophicus specifically, research has shown that growth in LGI medium with varying carbon sources affects protein expression, with glucose, sucrose, fructose, and mannitol (20 g/L) having differential effects on gene expression .

• How does pH affect the stability and function of recombinant G. diazotrophicus ATP synthase subunit b, and what buffer systems are optimal for purification?

The pH environment significantly impacts both the stability and function of ATP synthase components, including subunit b. Research on F-type ATP synthases has revealed critical pH dependencies that should be considered when working with recombinant G. diazotrophicus ATP synthase components:

pH Effects on ATP Synthase Function:
Recent research on F1F0 ATP synthase components has demonstrated that binding affinity for ATP can change up to 5.9-fold across physiologically relevant pH ranges (pH 7.0-8.5), with higher pH environments (8.0-8.5) generally favoring stronger nucleotide binding . While this specific study focused on the ε subunit, similar principles apply to other ATP synthase components including subunit b.

Molecular Basis for pH Sensitivity:
The pH sensitivity of ATP synthase components often involves histidine residues, which have a pKa of approximately 6.0-6.5 in solution but can be shifted by the local protein environment. Protonation state changes in these residues can significantly alter protein structure and function through:

• Modification of hydrogen bonding networks

• Changes in electrostatic interactions

• Alterations in protein-protein interaction interfaces

Optimal Buffer Systems by Application:

Buffer Additives for Enhanced Stability:

• Glycerol (20-50%): Prevents aggregation and increases shelf-life

• Salt (100-300 mM NaCl): Reduces non-specific interactions

• Divalent cations (5-10 mM MgCl2): Stabilizes nucleotide binding sites

• Protease inhibitors: Prevents degradation during purification

Research on bacterial ATP synthases indicates that pH optimization is critical for experimental success, with significant impacts on both structural stability and functional parameters . For G. diazotrophicus specifically, consideration of its natural environment within plant tissues (typically pH 5.5-6.5 in the apoplast) may provide insights into its evolved pH adaptations.

• What strategies can overcome the challenges of low expression yields and protein insolubility when working with recombinant G. diazotrophicus ATP synthase subunit b?

Membrane proteins like ATP synthase subunit b present significant challenges for recombinant expression, including low yields and poor solubility. The following advanced strategies address these specific challenges:

Genetic Engineering Approaches:

• Codon Optimization: Analyze the G. diazotrophicus atpF gene sequence for rare codons in the expression host and optimize accordingly

• Fusion Partners: Express atpF as a fusion with solubility-enhancing tags:

  • MBP (Maltose Binding Protein): Enhances solubility and provides affinity purification

  • SUMO (Small Ubiquitin-like Modifier): Improves folding and solubility

  • Thioredoxin: Assists in proper disulfide bond formation

• Expression Vector Modifications:

  • Use low-copy number vectors to reduce metabolic burden

  • Implement tightly controlled promoters to minimize toxicity

Host Cell Engineering:

• Specialized Expression Strains:

  • C41(DE3) and C43(DE3): E. coli strains optimized for membrane protein expression

  • Lemo21(DE3): Allows tunable expression levels via rhamnose-inducible system

• Chaperone Co-expression:

  • GroEL/GroES system: Assists in proper protein folding

  • DnaK/DnaJ/GrpE: Prevents aggregation during synthesis

Process Optimization:

• Expression Conditions:

  • Lower temperatures (16-25°C): Slows translation rate to improve folding

  • Mild induction: Lower IPTG concentrations (0.1-0.5 mM)

  • Extended expression time: 16-48 hours at reduced temperatures

• Media Formulations:

  • Supplemented with glycylglycine (50-100 mM): Buffers pH during growth

  • Addition of specific ions (5 mM Mg2+, 1 mM Zn2+): Supports proper folding

Solubilization and Purification Innovations:

• Detergent Screening Matrix:

  Detergent Class	Examples	Best For
  Mild Non-ionic	DDM, OG	Initial screening
  Zwitterionic	LDAO, Fos-choline	Higher extraction efficiency
  Steroid-based	Digitonin, CHAPS	Maintaining native interactions
  Polymer-based	Amphipols, SMALPs	Detergent-free approaches

• Membrane Mimetics:

  • Nanodiscs: Phospholipid bilayers stabilized by scaffold proteins

  • Liposomes: Reconstitution into artificial membranes

  • Bicelles: Disc-shaped lipid-detergent mixed micelles

These strategies have been successfully applied to other challenging membrane proteins, resulting in significant improvements in both yield and solubility. Specific research on GroEL/GroES purification from symbiotic bacteria has achieved yields of 56-62% with purity of 89-91% , providing benchmarks for successful membrane protein work.

• How can researchers accurately determine the kinetic parameters of recombinant G. diazotrophicus ATP synthase subunit b and its assembly into functional complexes?

Determining kinetic parameters and assembly characteristics of ATP synthase components requires sophisticated methodological approaches:

Kinetic Parameter Determination:

• ATPase Activity Assays:

  • Spectrophotometric Methods: Couple ATP hydrolysis to NADH oxidation using pyruvate kinase and lactate dehydrogenase

  • Malachite Green Assay: Quantify released inorganic phosphate

  • Luciferin-Luciferase Assay: Direct measurement of ATP concentration

• Data Collection Strategy:
  Measure reaction rates at varying substrate concentrations (typically 10-15 points spanning 0.1-10× Km) under constant conditions:

  • Fixed temperature (typically 25°C, 30°C, and 37°C)

  • Controlled pH (test range 6.5-8.5)

  • Defined ionic strength (100-200 mM KCl or NaCl)

• Kinetic Model Fitting:
  Apply appropriate models to determine key parameters:

  • Michaelis-Menten equation for simple kinetics

  • Hill equation for cooperative binding

  • Competitive inhibition models for substrate competition studies

Example Kinetic Analysis Protocol:

• Prepare reaction mixtures containing purified protein (0.1-1 μg)

• Initiate reaction with varying ATP concentrations (10-500 μM)

• Sample reaction at defined timepoints (0, 1, 2, 5, 10 min)

• Measure product formation using appropriate detection method

• Plot initial velocities vs. substrate concentration

• Fit data to appropriate kinetic model using non-linear regression

Research has shown that ATP-binding components of F-type ATP synthases exhibit pH-dependent binding parameters, with affinity changing up to 5.9-fold between pH 7.0 and 8.5 . This methodological approach enables precise determination of how environmental factors affect enzyme function.

Assembly Characterization Techniques:

• Blue Native PAGE:

  • Preserves native protein complexes during electrophoresis

  • Reveals oligomeric state and complex formation

• Analytical Ultracentrifugation:

  • Sedimentation velocity experiments determine size distribution

  • Sedimentation equilibrium reveals molecular weight and stoichiometry

• Chemical Cross-linking Mass Spectrometry:

  • Identifies interaction interfaces between subunits

  • Research on GroEL/GroES complexes confirmed oligomeric properties through cross-linking analysis

• Single-molecule FRET:

  • Measures distances between fluorescently labeled subunits

  • Provides dynamic information about assembly process

• What role does the ATP synthase subunit b play in the iron response and energy metabolism of G. diazotrophicus, and how can this be experimentally verified?

The ATP synthase subunit b plays a complex role in bacterial energy metabolism, with particular relevance to iron homeostasis in G. diazotrophicus, which has important implications for its endophytic lifestyle and nitrogen fixation capability:

Relationship Between ATP Synthase and Iron Homeostasis:

Transcriptomic studies of G. diazotrophicus have revealed that iron availability triggers significant changes in gene expression patterns, including those related to energy metabolism. Under iron-limited conditions, several genes encoding efflux pumps and transporters show differential expression, suggesting a complex relationship between iron homeostasis and energy-generating systems .

Key findings from G. diazotrophicus transcriptomic studies include:

• Several genes coding for efflux pumps of resistance-nodulation-division (RND) multidrugs were upregulated under iron limitation

• ATP-binding cassette (ABC) transporters showed altered expression patterns

• Iron deficiency affected expression of genes involved in bacterial chemotaxis and flagellar structure

While these studies don't specifically highlight ATP synthase subunit b, they establish a framework connecting iron availability, energy metabolism, and membrane transport systems in G. diazotrophicus.

Experimental Approaches to Verify ATP Synthase Roles:

• Gene Expression Analysis:

  • RT-qPCR Protocol: Extract RNA from G. diazotrophicus grown under varying iron concentrations, perform reverse transcription, and quantify atpF expression

  • RNA-Seq Analysis: Conduct global transcriptomic profiling under varying iron conditions to place atpF in context of the iron regulon

  • Reporter Fusions: Create atpF-lacZ reporter constructs to monitor expression under different conditions

• Protein Function Analysis:

  • Site-Directed Mutagenesis: Create specific mutations in atpF to identify functional domains

  • Protein-Protein Interaction: Use pull-down assays or bacterial two-hybrid systems to identify interacting partners

  • In vivo Functional Assays: Measure ATP synthesis rates in wild-type vs. atpF mutant strains

• Cellular Energy State Assessment:

  • ATP Measurement: Utilize recombinant luciferase systems to monitor ATP levels in different cellular compartments

  • Membrane Potential: Use fluorescent probes to measure proton motive force

  • Metabolic Flux Analysis: Track carbon flow through central metabolism under different iron conditions

Research on bacterial ATP micro-domains has demonstrated that glucose generates sub-plasma membrane ATP microdomains in certain cells, with strategically located mitochondria playing important roles . Similar approaches could be adapted to study ATP distribution in G. diazotrophicus under varying iron conditions.

Experimental Design Table:

This integrated experimental approach would establish the precise relationship between ATP synthase subunit b, iron homeostasis, and energy metabolism in G. diazotrophicus.

• How can researchers design genetic modifications to optimize recombinant G. diazotrophicus ATP synthase subunit b for studying protein-protein interactions within the ATP synthase complex?

Designing genetic modifications for studying protein-protein interactions within the ATP synthase complex requires strategic approaches that preserve functional integrity while enabling detection and analysis:

Strategic Tagging Approaches:

• Site-Specific Tag Placement:

  • N-terminal tags: Generally less disruptive for membrane proteins with cytoplasmic N-termini

  • C-terminal tags: May be tolerated if C-terminus is not involved in critical interactions

  • Internal tags: Insert at predicted loop regions based on structural models

• Tag Selection Strategy:

  Tag Type	Size	Application	Considerations for ATP synthase
  FLAG/HA/Myc	8-10 aa	Co-IP, Western blot	Minimal structural disruption
  His6/Strep-tag	6-8 aa	Affinity purification	May affect metal coordination
  Fluorescent proteins	25-30 kDa	Live-cell imaging	Large size may disrupt assembly
  Split tags (BiFC)	Variable	In vivo interaction	Allows visualization of complex assembly

• Linker Design Considerations:

  • Use flexible glycine-serine linkers (GGGGS)n to minimize structural constraints

  • Test multiple linker lengths (5, 10, 15 aa) to optimize tag accessibility

  • Consider rigid linkers (EAAAK)n when spatial separation is critical

Advanced Mutagenesis Strategies:

• Interface Mapping:

  • Create alanine scanning libraries across predicted interaction surfaces

  • Generate charge reversal mutations at electrostatic interfaces

  • Introduce cysteine pairs for disulfide cross-linking at interaction interfaces

• Chimeric Protein Construction:

  • Swap domains between homologous ATP synthase subunits from different species

  • Create fusion proteins with domains from interacting partners

  • Design reporter constructs that activate only upon successful interaction

Experimental Validation Approaches:

• In vivo Crosslinking:

  • Chemical crosslinkers with varying spacer lengths to capture transient interactions

  • Photo-activatable amino acid incorporation for precise spatiotemporal control

  • Mass spectrometry analysis of crosslinked products for interaction mapping

• Functional Complementation:

  • Express modified atpF in atpF-deletion backgrounds

  • Assess ATP synthesis/hydrolysis activities to validate functional integrity

  • Measure growth rates in conditions requiring oxidative phosphorylation

This systematic approach is supported by successful studies on other ATP synthase components, where chemical cross-linking analysis confirmed oligomeric properties of GroESx and GroELx as GroESx7 and GroELx14 in two stacks of GroELx7 . Similar approaches would be applicable to studying G. diazotrophicus ATP synthase subunit b interactions.

When implementing these strategies, it's important to note that studies of G. diazotrophicus have successfully used recombinant protein expression approaches. For example, researchers have generated recombinant G. diazotrophicus containing the Cry1Ac gene from Bacillus thuringiensis var. kurstaki using the pKT230 shuttle vector, demonstrating that this bacterium can successfully express recombinant proteins while maintaining native functions like nitrogenase activity .

• What computational approaches can predict the structure and functional domains of G. diazotrophicus ATP synthase subunit b to guide experimental design?

Advanced computational approaches provide powerful tools for predicting structural features and functional domains of proteins like G. diazotrophicus ATP synthase subunit b, offering crucial guidance for experimental design:

Sequence Analysis and Evolutionary Insights:

• Multiple Sequence Alignment (MSA):

  • Align atpF sequences from diverse bacterial species to identify conserved regions

  • Focus on alignments with well-characterized ATP synthase subunit b proteins

  • Use specialized alignment tools for membrane proteins (e.g., PRALINE-TM, TM-Coffee)

• Evolutionary Analysis:

  • Generate phylogenetic trees to place G. diazotrophicus atpF in evolutionary context

  • Calculate position-specific conservation scores to identify functionally important residues

  • Apply coevolutionary analysis to detect residue pairs likely involved in structural contacts

• Domain and Motif Prediction:

  • Search for known functional motifs using tools like PROSITE or SMART

  • Identify transmembrane regions using consensus prediction (TMHMM, HMMTOP, Phobius)

  • Predict secondary structure elements using PSIPRED or JPred

Structure Prediction and Molecular Modeling:

• Template-Based Modeling:

  • Identify suitable structural templates from well-characterized bacterial ATP synthases

  • Generate homology models using tools like SWISS-MODEL, Phyre2, or I-TASSER

  • Validate models using tools like MolProbity or PROCHECK

• Advanced Structure Prediction:

  • Apply AlphaFold2 or RoseTTAFold for highly accurate structure prediction

  • Refine models in membrane environments using molecular dynamics simulations

  • Validate predictions against experimental data when available

• Molecular Dynamics Simulations:

  • Embed protein models in simulated lipid bilayers

  • Analyze stability and conformational dynamics over 100+ ns simulations

  • Identify potential binding sites and interaction surfaces

Functional Annotation and Interface Prediction:

• Protein-Protein Interaction Sites:

  • Predict interaction interfaces using SPPIDER or PredUs

  • Apply docking simulations to model subunit b interactions with other ATP synthase components

  • Validate predictions through mutagenesis strategies

• Electrostatic Analysis:

  • Calculate surface electrostatic potentials to identify potential interaction regions

  • Analyze pH-dependent electrostatic properties, important for ATP synthase function

  • Identify potential proton pathways relevant to ATP synthase mechanism

Research on ATP synthase components has demonstrated the value of computational approaches, with molecular dynamics simulations successfully predicting how pH affects ATP binding sites through protonation state changes in key histidine residues . For G. diazotrophicus specifically, computational motif discovery tools have been used to define its response to iron availability , providing a methodological framework for similar analyses of ATP synthase components.

Implementation Workflow:

• Begin with sequence analysis to identify conserved regions and functional motifs

• Generate structural models using multiple prediction approaches

• Validate and refine models through molecular dynamics simulations

• Design targeted experiments based on computational predictions

• Iteratively improve models based on experimental results

This comprehensive computational approach provides a strong foundation for experimental design, enabling more targeted and efficient investigation of G. diazotrophicus ATP synthase subunit b structure and function.