Recombinant Gluconacetobacter diazotrophicus NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; GDI2471; Gdia_0718; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5)
Target Names
nuoA
Target Protein Sequence
MLAMSDFCTQHPLFSYAVAIVVLLAAMLGLGAVSGTRRVGAARGRSMDLPFESGVLPVGS AHLRIPVQYYLVAMLFVIFDVESVFLFSWAPVAVGAGWRGYGAVVVFVASLAAALAYVWR WGALDWGPVPRRRIDYRRAGDASCAGR
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, ubiquinone is considered the primary electron acceptor. This redox reaction is coupled to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of NADH-quinone oxidoreductase subunit A (nuoA) in Gluconacetobacter diazotrophicus?

NADH-quinone oxidoreductase subunit A (nuoA) is a component of the NADH:quinone oxidoreductase complex, also known as Complex I, which plays a critical role in cellular respiration. In Gluconacetobacter diazotrophicus, this enzyme facilitates the transfer of electrons from NADH to quinone molecules, a process coupled with proton translocation across the membrane. This activity contributes to the generation of a proton gradient essential for ATP synthesis through oxidative phosphorylation. The nuoA subunit specifically anchors other subunits within the membrane and ensures structural stability and electron flow efficiency .

How is recombinant nuoA typically expressed in laboratory settings?

Recombinant nuoA is commonly expressed using Escherichia coli as a host system due to its well-characterized genetics and ability to produce high yields of protein. The gene encoding nuoA is cloned into an expression vector, often fused with tags such as His-tags for simplified purification via affinity chromatography. Expression conditions, including temperature, induction time, and host strain selection, are optimized to achieve soluble and functional protein .

For example, recombinant full-length nuoA protein has been expressed as a His-tagged fusion protein in E. coli systems, yielding a lyophilized product with over 90% purity as determined by SDS-PAGE analysis .

What experimental methods are used to confirm the purity and functionality of recombinant nuoA?

The purity of recombinant nuoA is typically assessed using SDS-PAGE, which separates proteins based on their molecular weight. A purity level exceeding 90% is often considered suitable for downstream applications . Functional assays involve reconstituting the protein into lipid bilayers or testing its ability to interact with other Complex I subunits under controlled experimental conditions.

Additionally, circular dichroism (CD) spectroscopy may be employed to verify proper folding, while electron transfer assays using quinones as substrates can confirm enzymatic activity.

How can experimental design methodologies optimize recombinant nuoA expression?

Experimental design methodologies such as factorial design or response surface methodology (RSM) are powerful tools for optimizing recombinant protein expression. These approaches allow researchers to evaluate multiple variables simultaneously, including temperature, inducer concentration (e.g., IPTG), pH, and nutrient composition.

For instance, factorial designs can identify interactions between variables that influence protein yield and solubility. By systematically varying these parameters, researchers can establish optimal conditions for producing high-quality recombinant nuoA while minimizing resource use .

What challenges arise during the expression of membrane-associated proteins like nuoA?

Expressing membrane-associated proteins such as nuoA presents unique challenges due to their hydrophobic nature and tendency to aggregate when overexpressed in heterologous systems like E. coli. Common issues include:

  • Inclusion body formation: Misfolded proteins aggregate into insoluble inclusion bodies.

  • Low solubility: Hydrophobic transmembrane domains make it difficult to maintain solubility without detergents or specific lipid environments.

  • Functional instability: Improper folding or lack of post-translational modifications can impair functionality.

Strategies to address these challenges include co-expression with molecular chaperones, lowering induction temperatures to promote proper folding, and using specialized detergents or lipids during purification .

How can site-directed mutagenesis be used to study functional residues in nuoA?

Site-directed mutagenesis enables researchers to investigate the roles of specific amino acid residues within nuoA by introducing targeted changes in its sequence. For example:

  • Substitution mutations can identify residues critical for structural stability or interactions with other subunits.

  • Deletion mutations can reveal regions essential for anchoring within membranes.

  • Conservative mutations help assess the importance of chemical properties like charge or hydrophobicity.

Functional assays following mutagenesis provide insights into how specific residues contribute to electron transfer efficiency or Complex I assembly.

What are best practices for purifying recombinant nuoA?

Purification protocols for recombinant nuoA often involve affinity chromatography leveraging His-tags fused to the protein's N-terminal region. Key steps include:

  • Cell lysis: Disruption of E. coli cells using sonication or chemical methods.

  • Binding: Passing lysates through nickel-nitrilotriacetic acid (Ni-NTA) columns under native conditions.

  • Elution: Using imidazole gradients to selectively elute bound proteins.

  • Polishing: Employing size-exclusion chromatography (SEC) for further purification.

Maintaining low temperatures throughout these steps minimizes proteolytic degradation and aggregation .

How can researchers validate interactions between nuoA and other Complex I subunits?

Protein-protein interaction studies involving nuoA can be performed using techniques such as:

  • Co-immunoprecipitation (Co-IP): Detects physical interactions under native conditions.

  • Crosslinking experiments: Stabilizes transient interactions for analysis via mass spectrometry.

  • Cryo-electron microscopy (cryo-EM): Provides high-resolution structural data on subunit arrangements within Complex I.

Combining these methods with mutagenesis studies offers a comprehensive understanding of how nuoA contributes to Complex I assembly and function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.