Recombinant Gluconacetobacter diazotrophicus NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly packed with blue ice packs. If you require dry ice packaging, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. To maintain optimal quality, avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preference for a particular tag, please communicate it to us, and we will prioritize its development.
Synonyms
nuoK; GDI2462; Gdia_0709; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Species
Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5)
Target Names
nuoK
Target Protein Sequence
MIMRPTPDMAMLLAAGLFALGLLGVLVRRNLLFMLMSIEIMLNAAALAFVAAGTRWHAAE GQVMFLMILSLAAAEAAIGLAILLRMHQAGRPTLDADTGNRLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, ubiquinone is believed to be the immediate electron acceptor for the enzyme. The enzyme couples the redox reaction with proton translocation, where for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane. This process conserves the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of NADH-quinone oxidoreductase subunit K (nuoK) in Gluconacetobacter diazotrophicus?

The NADH-quinone oxidoreductase subunit K (nuoK) is a component of the respiratory complex I in G. diazotrophicus, which is crucial for energy metabolism during both aerobic and microaerobic growth. This protein is part of the membrane domain of complex I and contributes to proton translocation across the bacterial membrane, generating the proton motive force necessary for ATP synthesis. In G. diazotrophicus, this energy generation system is particularly important during nitrogen fixation, which is an energetically demanding process requiring substantial ATP input .

How does nuoK relate to nitrogen fixation capability in G. diazotrophicus?

NuoK functions within the respiratory chain to generate energy required for the nitrogen fixation process. While not directly involved in nitrogen fixation like the nif genes, the electron transport chain components including nuoK provide the ATP necessary to power nitrogenase activity. G. diazotrophicus requires microaerobic conditions for diazotrophic growth, and its respiratory chain must be adapted to function efficiently under these conditions to support the energy-intensive process of biological nitrogen fixation . The balance between oxygen respiration and protection of oxygen-sensitive nitrogenase is partially maintained through the regulated activity of respiratory complexes including complex I, of which nuoK is a component.

How conserved is the nuoK gene across different strains of G. diazotrophicus?

The nuoK gene appears to be highly conserved across different strains of G. diazotrophicus, reflecting its essential role in cellular energy metabolism. Comparative genomic analyses of various G. diazotrophicus strains show that genes involved in core metabolic functions, including respiratory chain components, display high sequence conservation. This conservation underscores the fundamental importance of energy generation systems for bacterial survival and suggests that nuoK may be under purifying selection pressure. Unlike some nitrogen regulation genes that show redundancy through multiple homologs (such as amtB1 and amtB2), respiratory chain components like nuoK typically show less redundancy in G. diazotrophicus .

What expression systems are most effective for producing recombinant G. diazotrophicus nuoK?

For the expression of recombinant G. diazotrophicus nuoK, E. coli-based expression systems are commonly employed with specific modifications to accommodate membrane protein expression. The pET expression system using E. coli BL21(DE3) with codon optimization for G. diazotrophicus genes has shown good results. For optimal expression:

  • Clone the nuoK gene into a vector containing a strong inducible promoter (T7 or tac)

  • Include a His-tag or other affinity tag to facilitate purification

  • Transform into an expression strain lacking proteases (BL21 derivatives)

  • Induce expression at lower temperatures (16-20°C) to facilitate proper membrane protein folding

  • Use specialized media supplements like betaine and sorbitol to enhance membrane protein expression

For membrane proteins like nuoK, expression levels are typically optimized by testing various induction conditions (IPTG concentration, induction time, temperature) and membrane-protein-friendly E. coli strains such as C41(DE3) or C43(DE3).

What are the optimal purification methods for recombinant nuoK protein?

Purification of recombinant nuoK requires specialized techniques due to its membrane-embedded nature:

Table 1: Purification Protocol for Recombinant nuoK

StepMethodBuffer CompositionPurpose
1Cell lysis50 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM PMSF, DNase IRelease cellular contents
2Membrane isolationUltracentrifugation at 100,000 × g, 1 hour, 4°CSeparate membrane fraction
3Membrane solubilization50 mM Tris-HCl pH 8.0, 150 mM NaCl, 1% n-dodecyl-β-D-maltoside (DDM)Extract membrane proteins
4Affinity chromatographyNi-NTA with 20-250 mM imidazole gradientCapture His-tagged nuoK
5Size exclusionSuperdex 200 with 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.03% DDMRemove aggregates and ensure protein homogeneity

For optimal results, all buffers should be supplemented with 0.03% DDM or another suitable detergent throughout purification steps to maintain protein solubility and stability. Alternative detergents such as LMNG or CHS/DDM mixtures may provide better stability for functional studies of nuoK.

How can researchers verify the proper folding and functionality of recombinant nuoK?

Verification of properly folded and functional recombinant nuoK can be assessed through multiple complementary approaches:

Researchers should consider that nuoK functions as part of a multi-subunit complex, and assessing its individual functionality may require reconstitution with other complex I components.

How does nuoK contribute to G. diazotrophicus energy metabolism during microaerobic nitrogen fixation?

The nuoK subunit plays a critical role in energy metabolism during microaerobic nitrogen fixation in G. diazotrophicus by:

  • Contributing to proton translocation across the bacterial membrane as part of complex I

  • Supporting the generation of proton motive force needed for ATP synthesis

  • Facilitating electron transfer through the respiratory chain under microaerobic conditions

G. diazotrophicus requires microaerobic conditions for diazotrophic growth, and the respiratory chain must balance the need for energy generation with the protection of the oxygen-sensitive nitrogenase complex . Complex I containing nuoK is particularly important in this balance, as it can function efficiently under lower oxygen tensions compared to other respiratory complexes. The energy produced is crucial because biological nitrogen fixation is an ATP-intensive process, requiring approximately 16 ATP molecules to reduce one N₂ molecule to two NH₃ molecules.

Is nuoK essential for G. diazotrophicus growth and what phenotypes are associated with nuoK mutations?

Based on transposon insertion studies in G. diazotrophicus, disruptions in respiratory chain components often lead to significant fitness defects, particularly under diazotrophic growth conditions . While specific nuoK disruption studies have not been detailed in the provided search results, mutations in respiratory complex components typically result in:

  • Reduced growth rates, especially under microaerobic conditions

  • Decreased nitrogen fixation capabilities

  • Altered colonization patterns in plant hosts

  • Impaired adaptation to environmental stresses

The severity of these phenotypes would depend on:

  • The degree of functional redundancy in the respiratory chain

  • Environmental conditions (oxygen availability, carbon source)

  • The availability of alternative electron transport pathways

G. diazotrophicus contains limited functional redundancy in genes related to nitrogen fixation compared to other diazotrophs , suggesting that nuoK mutations could have substantial impacts on bacterial fitness.

How does nuoK activity correlate with ammonium release during biological nitrogen fixation?

The activity of respiratory chain components like nuoK indirectly influences ammonium release during biological nitrogen fixation through their impact on cellular energy status. Recent research indicates that G. diazotrophicus can release fixed nitrogen as ammonium to benefit host plants . The correlation between nuoK activity and ammonium release involves:

  • Energy supply for nitrogenase: Higher nuoK activity supports more efficient ATP production, potentially enhancing nitrogenase activity and subsequent ammonium production.

  • Redox balance maintenance: Complex I contributes to cellular redox balance, which influences the electron flow to nitrogenase and thus nitrogen fixation efficiency.

  • Proton gradient utilization: The proton gradient generated partially through nuoK activity may influence ammonium transport processes across bacterial membranes.

Researchers investigating this correlation should consider experimental designs that allow simultaneous measurement of respiratory chain activity, ATP production rates, and extracellular ammonium release under controlled microaerobic conditions.

How can researchers use site-directed mutagenesis to analyze structure-function relationships in G. diazotrophicus nuoK?

Site-directed mutagenesis of G. diazotrophicus nuoK provides powerful insights into structure-function relationships of this important respiratory protein. A comprehensive approach should include:

  • Target Selection Based on Conservation Analysis: Identify highly conserved residues across bacterial nuoK proteins, particularly focusing on those implicated in proton translocation or quinone interaction.

  • Systematic Mutation Strategy:

Table 2: Recommended Mutation Types for nuoK Functional Analysis

Mutation TypeTarget ResiduesExpected ImpactAnalytical Methods
Conservative substitutionsCharged residues in transmembrane domainsAltered proton translocation efficiencyGrowth rate analysis, membrane potential measurements
Alanine scanningHighly conserved residuesIdentification of functionally essential residuesComplementation assays, NADH oxidation rates
Cysteine substitutionsResidues predicted to line proton channelsStructure mapping through accessibility studiesSCAM (substituted-cysteine accessibility method)
Proline insertionsTransmembrane helicesDisruption of helical structuresCD spectroscopy, activity assays
  • Expression and Analysis: Express mutated versions in a heterologous system or in G. diazotrophicus nuoK deletion strains for complementation studies.

  • Functional Assays: Measure NADH:ubiquinone oxidoreductase activity, proton pumping efficiency, and growth under various conditions (aerobic, microaerobic, different carbon sources).

  • In planta Testing: Assess how specific mutations affect plant colonization and nitrogen provision to host plants through inoculation experiments with mutant strains.

The results should be interpreted within the context of the entire complex I structure, as nuoK functions as part of this larger assembly.

What techniques can be used to study interactions between nuoK and other components of the respiratory chain in G. diazotrophicus?

Investigating protein-protein interactions involving nuoK requires specialized approaches suitable for membrane protein complexes:

  • Co-immunoprecipitation (Co-IP) with Membrane-Specific Modifications:

    • Utilize chemical crosslinking prior to solubilization

    • Employ membrane-compatible detergents (DDM, LMNG)

    • Use antibodies against nuoK or tagged versions of the protein

  • Bacterial Two-Hybrid Systems Adapted for Membrane Proteins:

    • BACTH (Bacterial Adenylate Cyclase Two-Hybrid) system

    • Split-ubiquitin yeast two-hybrid adapted for bacterial proteins

  • Native Gel Electrophoresis:

    • Blue Native PAGE to preserve protein complexes

    • Subsequent Western blotting to identify specific components

  • Proximity Labeling Methods:

    • BioID or APEX2 fusions to nuoK to identify proximal proteins

    • Mass spectrometry analysis of labeled proteins

  • Advanced Microscopy Techniques:

    • FRET analysis with fluorescently tagged proteins

    • Super-resolution microscopy to visualize complex formation

  • Reconstitution Studies:

    • In vitro reconstitution of partial or complete complex I

    • Activity measurements with defined component combinations

These approaches can reveal how nuoK interacts with other subunits of complex I and potentially with other respiratory chain components or regulatory proteins in G. diazotrophicus.

How do environmental factors influence nuoK expression and activity in G. diazotrophicus during plant colonization?

Environmental factors significantly impact nuoK expression and activity during plant colonization, as G. diazotrophicus must adapt its energy metabolism to different plant tissues and conditions:

  • Oxygen Availability:

    • The oxygen gradient from root surface to inner tissues affects respiratory chain component expression

    • G. diazotrophicus requires microaerobic conditions for diazotrophic growth

    • Different plant tissues provide varying oxygen concentrations (roots vs. stems)

  • Carbon Source Availability:

    • Plants provide different carbon sources in different tissues

    • Expression of respiratory chain components may be regulated based on carbon source

    • Sugar concentration influences both colonization patterns and metabolic activity

  • Nitrogen Status:

    • Plant nitrogen status affects bacterial nitrogen fixation

    • Under nitrogen limitation, increased expression of nitrogen fixation machinery demands greater energy production

    • Respiratory chain components may be upregulated to support increased ATP demand

  • Plant Defense Responses:

    • Reactive oxygen species produced during plant defense can damage respiratory chain components

    • Regulation of respiratory chain composition may help mitigate this stress

  • Developmental Stage of Host Plant:

    • Bacterial colonization patterns change throughout plant development

    • Different plant growth stages may require adaptation of bacterial energy metabolism

Researchers investigating these relationships should consider experimental designs that control these variables while monitoring both nuoK expression (via qRT-PCR or reporter constructs) and bacterial metabolic activity in different plant tissues and under varying environmental conditions.

What are common challenges in expressing recombinant G. diazotrophicus nuoK and how can they be addressed?

Recombinant expression of membrane proteins like G. diazotrophicus nuoK presents several technical challenges:

Table 3: Common Challenges and Solutions for nuoK Expression

ChallengeCauseSolution
Low expression levelsToxicity of membrane protein overexpressionUse tightly regulated inducible systems; lower induction temperature to 16-20°C; use specialized E. coli strains (C41/C43)
Inclusion body formationImproper folding or overwhelming of membrane insertion machineryCo-express molecular chaperones (GroEL/GroES); add membrane-stabilizing agents (glycerol, sucrose); reduce expression rate
Protein instabilityDetergent-mediated destabilizationScreen multiple detergents; add lipids to stabilize protein; use amphipols or nanodiscs for purified protein
Lack of functionalityImproper folding or missing interaction partnersCo-express with other complex I components; reconstitute in liposomes with lipids from G. diazotrophicus
Poor solubilizationInefficient extraction from membraneTest different detergent:protein ratios; try harsher detergents for extraction, then exchange to milder ones

Additional strategies include designing constructs with soluble fusion partners (MBP, SUMO) that can be later cleaved, and implementing high-throughput screening of expression conditions using fluorescent tags to rapidly identify optimal parameters.

How can researchers troubleshoot protein misfolding issues when working with recombinant nuoK?

Troubleshooting misfolding of recombinant nuoK requires a systematic approach:

  • Diagnostic Tests for Protein Folding:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Fluorescence spectroscopy to evaluate tertiary structure

    • Size exclusion chromatography to detect aggregation

    • Limited proteolysis to probe for stable domains versus unfolded regions

  • Expression Parameter Optimization:

    • Temperature screening (37°C, 30°C, 25°C, 20°C, 16°C)

    • Inducer concentration titration

    • Addition of chemical chaperones (glycerol, TMAO, arginine)

    • Evaluation of different growth media formulations

  • Genetic Modifications:

    • Co-expression with chaperone systems (GroEL/GroES, DnaK/DnaJ/GrpE)

    • Expression in strains with altered membrane compositions

    • Testing truncated constructs focusing on stable domains

    • Introduction of stabilizing mutations based on homology modeling

  • Post-extraction Stabilization:

    • Lipid supplementation during purification

    • Screening of detergent/lipid mixtures

    • Use of protein stabilizers (glycerol, arginine, specific ligands)

    • Reconstitution into nanodiscs or liposomes to provide native-like environment

Researchers should implement a step-wise optimization strategy, documenting the impact of each modification on protein folding and stability through consistent analytical methods.

What are the best approaches for studying nuoK in the context of complete complex I assembly?

Studying nuoK within the context of the complete complex I assembly requires specialized approaches:

  • Native Complex Isolation:

    • Develop gentle membrane solubilization protocols using mild detergents

    • Employ Blue Native PAGE to isolate intact complex I

    • Use affinity tags on nuoK to pull down the entire complex

    • Apply sucrose gradient ultracentrifugation for complex purification

  • Heterologous Co-expression Systems:

    • Design multi-gene expression vectors containing nuoK and interacting subunits

    • Utilize bacterial artificial chromosomes (BACs) to express larger gene clusters

    • Implement regulated expression systems to ensure proper stoichiometry

    • Co-express assembly factors identified in G. diazotrophicus

  • In situ Analysis:

    • Develop fluorescently tagged nuoK for localization studies

    • Use FRET pairs on different subunits to monitor assembly

    • Apply super-resolution microscopy to visualize complex formation

    • Employ proximity labeling to identify spatial relationships

  • Reconstitution Approaches:

    • Develop a step-wise reconstitution protocol for complex I subunits

    • Establish activity assays for partially assembled complexes

    • Use liposome reconstitution to measure proton pumping activity

    • Apply cryo-EM to characterize reconstituted complexes

  • Genetic Approaches:

    • Create conditional nuoK mutants in G. diazotrophicus

    • Develop reporter systems to monitor complex I assembly

    • Use transposon mutagenesis to identify assembly factors

    • Implement CRISPR interference to modulate nuoK expression

These approaches can be complemented with computational methods such as molecular dynamics simulations to predict the impact of nuoK within the complex I structure and function.

How can studies of nuoK contribute to improving nitrogen fixation efficiency in G. diazotrophicus?

Studies of nuoK can significantly contribute to improving nitrogen fixation efficiency in G. diazotrophicus through several research avenues:

  • Energy Optimization: Since nitrogen fixation is highly energy-intensive, understanding and optimizing the respiratory chain through nuoK modifications could lead to strains with enhanced ATP production efficiency, directly supporting nitrogenase activity.

  • Microaerobic Adaptation: Engineering nuoK and related respiratory components for improved function under the microaerobic conditions required for nitrogen fixation could enhance bacterial performance in plant tissues with varying oxygen concentrations.

  • Stress Tolerance: Modifications to nuoK that improve respiratory chain stability under environmental stresses could produce more robust nitrogen-fixing strains for agricultural applications.

  • Host Range Expansion: Understanding how nuoK contributes to bacterial energy metabolism in different plant environments could facilitate adaptation of G. diazotrophicus to new crop species beyond its traditional hosts.

  • Metabolic Integration: Coordinating respiratory chain activity with nitrogen fixation through targeted modifications of nuoK regulation could synchronize energy generation with nitrogen fixation demands.

Practical applications could include developing G. diazotrophicus strains with enhanced colonization abilities and nitrogen provision for important crops, potentially reducing the need for chemical fertilizers in sustainable agricultural systems .

What role might nuoK play in the adaptation of G. diazotrophicus to different plant hosts?

The nuoK subunit likely plays a significant role in the adaptation of G. diazotrophicus to different plant hosts through its central function in energy metabolism:

  • Tissue-Specific Adaptation: Different plant tissues present varying microenvironments (oxygen levels, carbon sources) that require specialized respiratory chain function. G. diazotrophicus has been shown to colonize different plant tissues with varying densities , suggesting adaptation to these microenvironments.

  • Host Carbon Utilization: Different plant hosts provide varying carbon sources, requiring adaptation of respiratory metabolism. The nuoK function may be modulated to optimize energy generation from available carbon compounds in different host plants.

  • Oxygen Gradient Navigation: Plants create oxygen gradients from the surface to inner tissues, and G. diazotrophicus must navigate these as it colonizes the plant. The respiratory chain containing nuoK must function across these oxygen gradients, particularly maintaining efficiency in the microaerobic conditions required for nitrogen fixation .

  • Defense Response Tolerance: Plant host defense responses often include oxidative bursts that can damage bacterial respiratory chains. Variations in nuoK structure or regulation might contribute to protection against host-derived reactive oxygen species.

  • Colonization Pattern Support: G. diazotrophicus shows different colonization patterns in various plant tissues . The energy metabolism supported by nuoK and other respiratory chain components likely plays a key role in sustaining bacterial populations in different plant compartments.

Researchers studying G. diazotrophicus adaptation to new hosts should consider measuring respiratory chain component expression and activity across different plant tissues and correlating these with colonization success.

How can structural information about nuoK inform the development of enhanced biofertilizer strains?

Structural insights into nuoK can guide rational engineering of enhanced G. diazotrophicus biofertilizer strains:

The development of enhanced biofertilizer strains based on nuoK engineering could contribute to sustainable agricultural systems by improving biological nitrogen fixation efficiency, reducing the need for chemical fertilizers while maintaining or improving crop yields .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.