Recombinant Gluconacetobacter diazotrophicus Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties and Catalytic Mechanism

UppP hydrolyzes UPP into UP and inorganic phosphate, a reaction vital for recycling the lipid carrier during cell wall synthesis :

UPP+H2OUP+Pi\text{UPP} + \text{H}_2\text{O} \rightarrow \text{UP} + \text{P}_i

Key biochemical features:

Functional Role in Bacterial Physiology

UppP is indispensable for:

  • Peptidoglycan Biosynthesis: Recycles UP for glycan chain polymerization .

  • Exopolysaccharide (EPS) Production: Supports G. diazotrophicus colonization of plants via gum-like polysaccharide clusters .

  • Antibiotic Resistance: Confers bacitracin resistance by maintaining UP pools .

Disruption of uppP or related genes (e.g., gumD) abolishes EPS production in G. diazotrophicus, impairing plant symbiosis .

Table 1: Key Research Insights

Study FocusFindingsSource
Enzyme InhibitionBacA/UppP inhibitors identified via virtual screening block UP recycling.
EPS BiosynthesisuppP mutants show 90–94% reduction in EPS production.
Plant ColonizationEPS-deficient strains fail to form symbiotic biofilms in sugarcane.
Antibiotic InteractionsBacitracin sequesters UPP, highlighting UppP’s role in resistance.

Biotechnological and Therapeutic Potential

  • Antibiotic Development: UppP is a validated target for novel antibacterials .

  • Agricultural Bioengineering: Recombinant UppP aids in studying G. diazotrophicus-plant interactions for crop improvement .

  • Enzyme Assays: Commercial ELISA kits (e.g., Afigen’s 50 µg recombinant protein) enable high-throughput screening .

Genetic and Genomic Context

The uppP gene resides in a genomic region encoding polysaccharide biosynthesis machinery, including glycosyltransferases and transporters . G. diazotrophicus genome analysis reveals horizontal gene transfer events shaping its EPS synthesis pathways .

Challenges and Future Directions

  • Structural Studies: Resolving the 3D structure of G. diazotrophicus UppP could inform inhibitor design .

  • In Vivo Functional Analysis: Linking UppP activity to bacterial fitness in plant hosts remains underexplored .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for guaranteed fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
uppP; GDI1791; Gdia_0020; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5)
Target Names
uppP
Target Protein Sequence
MDSRTMTLIQAIVIAILQGATELFPVSSLGHAVIVPALLGWAFDPHGEIFLPFLVMLHLG TAIALLVYFRNDWAAIFQGLRGRDGSQRQAESIHILALLVVATIPAVIIGGLLEHWLRAL FGTARYAAIFLFLNGLLLLLTERMKSRQPVQGGYAIASLTYADAAIIGLWQCLAFLPGIS RSGATIIGALFRGLNHEGAARFSFLMAQPVIIAATVREALHMRHVAIPPGQMQVATIGAM VAAVTALASTAFLMRYFHNHERWALSPFGYYCVLAGAVSFFILGH
Uniprot No.

Target Background

Function

Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) and confers resistance to bacitracin.

Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Gluconacetobacter diazotrophicus and why is it significant in plant-microbe research?

Gluconacetobacter diazotrophicus is a nitrogen-fixing, Gram-negative acetic acid bacterium that was first isolated from sugarcane plants in Brazil in 1988. It is classified as an endophyte, meaning it lives within plant tissues rather than existing as a free-living soil bacterium. This microorganism primarily resides in the apoplast of plants, colonizing both roots and stems, and has been shown capable of xylem colonization .

The significance of G. diazotrophicus in research stems from its unique ability to perform biological nitrogen fixation (BNF) while colonizing a wide range of host plants. This makes it valuable as a biofertilizer that can promote plant growth while reducing dependency on chemical nitrogen fertilizers, which are associated with high energy costs and environmental damage through greenhouse gas emissions .

Beyond nitrogen fixation, G. diazotrophicus synthesizes various phytohormones including Indole-3-acetic acid and gibberellins A1 and A3, contributing to its plant growth-promoting effects . Additionally, research has revealed that G. diazotrophicus can elicit plant defense responses, enhancing resistance against pathogens such as Xanthomonas albilineans .

How can researchers effectively produce and purify recombinant G. diazotrophicus uppP?

Expression System Selection:
For recombinant production of G. diazotrophicus uppP, researchers should consider that uppP is a membrane-associated enzyme. Based on successful approaches with similar proteins:

  • E. coli-based expression systems: BL21(DE3) or C41(DE3) strains are recommended due to their tolerance for membrane protein expression. Use vectors containing T7 promoters (such as pET series) or arabinose-inducible promoters (pBAD series).

  • Fusion partners: Consider adding N-terminal fusion tags such as His6, MBP (maltose-binding protein), or GST (glutathione S-transferase) to enhance solubility and facilitate purification. The tag type will need to be determined during the production process for optimal results .

Purification Protocol:
For membrane proteins like uppP, this general protocol can be adapted:

  • Transform expression vector into chosen E. coli strain

  • Grow culture to OD600 = 0.6-0.8 at 37°C

  • Induce with IPTG (0.1-0.5 mM) or arabinose (0.02-0.2%)

  • Continue expression at lower temperature (16-25°C) for 16-20 hours

  • Harvest cells and resuspend in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl

  • Disrupt cells using sonication or French press

  • Solubilize membrane fraction using detergents (DDM, LDAO, or Triton X-100)

  • Perform affinity chromatography using the fusion tag

  • Consider size exclusion chromatography as a final purification step

  • Store in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage

Storage Recommendations:
The purified protein should be stored in a Tris-based buffer with 50% glycerol optimized for this protein. For long-term storage, maintain at -20°C or -80°C. For working aliquots, store at 4°C for up to one week. Repeated freezing and thawing is not recommended as it may affect protein activity and stability .

What assays can be used to measure the enzymatic activity of recombinant uppP?

Colorimetric Phosphate Release Assay:

  • Reaction mixture containing purified uppP enzyme, undecaprenyl pyrophosphate substrate, and appropriate buffer

  • Incubate at optimal temperature (typically 30-37°C)

  • Detect released inorganic phosphate using malachite green or molybdate-based colorimetric detection

  • Measure absorbance at 620-660 nm

  • Calculate enzyme activity using a phosphate standard curve

Coupled Enzyme Assay:

  • Link uppP activity to a secondary enzyme reaction that produces a measurable product

  • For example, couple with pyruvate kinase and lactate dehydrogenase to monitor NADH oxidation

  • Monitor decrease in absorbance at 340 nm as NADH is converted to NAD+

  • Calculate uppP activity based on the rate of NADH consumption

HPLC-based Assay:

  • Incubate purified uppP with undecaprenyl pyrophosphate substrate

  • Extract lipid products using organic solvents

  • Analyze reaction products by HPLC with C18 reverse-phase column

  • Monitor UV absorbance or use mass spectrometry for detection

  • Quantify undecaprenyl phosphate production relative to standards

How can researchers generate and validate uppP mutants in G. diazotrophicus?

Based on successful approaches used with G. diazotrophicus and similar bacteria, researchers can use the following methods:

Mutant Generation:

  • Plasmid-based gene disruption: Design constructs containing the uppP gene with insertion of antibiotic resistance cassette

  • CRISPR-Cas9 system: Design sgRNAs targeting the uppP gene

  • Homologous recombination: Prepare flanking regions of uppP for targeted gene replacement

For transformation methods, electroporation has been successfully used with G. diazotrophicus, as demonstrated in previous studies where gfp-tagged strains were created using this approach . The protocol involves:

  • Prepare electrocompetent G. diazotrophicus cells

  • Transfer 100 μl of cells to a chilled 2 mm electroporation cuvette

  • Add the disruption/mutation construct

  • Subject to a 1800 V pulse in a Gene Pulser apparatus

  • Select positive clones on appropriate selective media

Mutant Validation:

  • PCR verification: Use primers flanking the mutation site to confirm correct integration

  • Sequencing: Verify the sequence of the mutated region

  • RT-PCR or RNA-Seq: Confirm altered gene expression

  • Biochemical assays: Assess changes in uppP enzymatic activity

  • Phenotypic characterization: Examine changes in cell morphology, growth, and antibiotic sensitivity

This approach is supported by research showing that mutations affecting the Und-P synthetic pathway can lead to altered cell morphology and growth characteristics, particularly at elevated temperatures, as demonstrated in E. coli studies .

How does uppP function contribute to bacterial antibiotic resistance mechanisms?

Undecaprenyl-diphosphatase (uppP) plays a significant role in bacterial antibiotic resistance, particularly against compounds targeting cell wall biosynthesis. This enzyme is also known as "Bacitracin resistance protein" , which directly points to its role in antibiotic resistance mechanisms.

Mechanism of Resistance:

  • Bacitracin resistance: Bacitracin inhibits cell wall synthesis by binding to undecaprenyl pyrophosphate, preventing its recycling. UppP counteracts this by rapidly dephosphorylating undecaprenyl pyrophosphate to undecaprenyl phosphate, limiting the target available for bacitracin .

  • Peptidoglycan synthesis maintenance: By ensuring continued availability of the Und-P carrier lipid, uppP helps maintain peptidoglycan synthesis even in the presence of antibiotics that target various steps in this pathway.

  • Cell wall integrity: Proper function of uppP ensures normal cell morphology and wall integrity, which can affect the permeability barrier against various antibiotics .

Research Applications:
Researchers can leverage this understanding to:

  • Study uppP as a potential target for novel antimicrobial compounds

  • Investigate combinations of uppP inhibitors with existing antibiotics for synergistic effects

  • Explore the potential for uppP mutations to alter antibiotic susceptibility profiles in G. diazotrophicus

What role does uppP play in G. diazotrophicus colonization of plant hosts?

While the search results don't directly address uppP's role in G. diazotrophicus plant colonization, we can infer its importance based on understanding of bacterial cell wall synthesis and colonization mechanisms:

Potential Roles in Colonization:

  • Cell morphology maintenance: Proper uppP function ensures normal bacterial cell shape, which could be crucial during the colonization process. Research has shown that mutations affecting Und-P synthesis can lead to aberrant morphology , which might impair the ability of bacteria to navigate plant tissues.

  • Adaptation to plant microenvironments: G. diazotrophicus has been observed to undergo morphological transitions during colonization, including filamentous forms in endophytic regions . UppP-mediated cell wall synthesis likely plays a role in these adaptations.

  • Biofilm formation: G. diazotrophicus forms biofilms during colonization, as observed through microscopy studies using fluorescently tagged bacteria . Cell wall synthesis enzymes including uppP would be essential for the structural integrity of these biofilms.

Experimental Evidence:
Imaging studies using fluorescently tagged G. diazotrophicus have revealed complex colonization patterns, with bacteria observed in both coccoidal and filamentous forms depending on their location within plant tissues . The transition between these forms requires active cell wall remodeling, in which uppP would play a crucial role.

What is the relationship between uppP and bacterial morphology during different growth phases?

The relationship between uppP and bacterial morphology is significant, particularly during transitions between growth phases and environmental adaptations:

Morphological Implications:

  • Temperature sensitivity: Research in E. coli has shown that mutations affecting the Und-P synthetic pathway (including uppS, which works in the same pathway as uppP) can cause cells to exhibit highly aberrant morphology when grown at elevated temperatures (42°C) . This suggests that uppP activity may be particularly crucial under stress conditions.

  • Growth phase transitions: The rate of peptidoglycan synthesis varies during different growth phases, requiring coordinated regulation of all enzymes involved, including uppP.

  • Filamentous vs. coccoidal forms: G. diazotrophicus exhibits different morphologies (filamentous and coccoidal) depending on its location within host plants . These transitions likely involve differential regulation of cell wall synthesis enzymes including uppP.

Table 1: Observed Morphological Changes Associated with Cell Wall Synthesis Pathway Mutations

MutationGrowth TemperatureObserved MorphologyReference
uppS31 (E. coli)42°CHighly aberrant
uppS31 in MG165530°CLethal
uppS31 + ispH + idi mutations42°CAberrant but viable

What are common challenges in working with recombinant uppP and how can they be addressed?

Challenge 1: Low Expression Yields

  • Problem: Membrane proteins like uppP often express poorly in recombinant systems

  • Solutions:

    • Try lower induction temperatures (16-20°C)

    • Reduce inducer concentration

    • Test different E. coli strains specialized for membrane proteins (C41, C43)

    • Consider codon optimization for the expression host

    • Use fusion partners known to enhance solubility (MBP, SUMO)

Challenge 2: Protein Inactivity After Purification

  • Problem: Loss of enzymatic activity during purification

  • Solutions:

    • Include appropriate detergents (DDM, LDAO) throughout purification

    • Add lipids to stabilize the protein

    • Avoid harsh elution conditions

    • Include glycerol (20-50%) in storage buffers

    • Test activity immediately after purification

Challenge 3: Storage Stability Issues

  • Problem: Activity loss during storage

  • Solutions:

    • Store in Tris-based buffer with 50% glycerol at -20°C or -80°C

    • Divide into small aliquots to avoid repeated freeze-thaw cycles

    • For working stocks, store at 4°C for no more than one week

    • Consider lyophilization for long-term storage

How can researchers interpret contradictory results when studying uppP function?

When faced with contradictory results in uppP research, consider these methodological approaches:

Systematic Troubleshooting Framework:

  • Verify protein quality:

    • Confirm protein purity by SDS-PAGE

    • Validate protein folding using circular dichroism

    • Check for post-purification degradation

  • Examine assay conditions:

    • Test multiple buffer systems (pH range 6.0-8.5)

    • Vary divalent cation concentrations (Mg²⁺, Mn²⁺, Ca²⁺)

    • Control for detergent effects on enzyme activity

  • Address experimental variables:

    • Different substrate sources may vary in purity

    • Temperature sensitivity of uppP activity

    • Phase of bacterial growth when harvested

  • Consider genetic context:

    • Compensatory mutations may mask phenotypes

    • Strain-specific genetic backgrounds can influence results

    • Regulatory elements affecting uppP expression may vary

Case Study Analysis:
In E. coli research, a mutation in uppS (in the same pathway as uppP) was lethal in one genetic background (MG1655) but viable in another (CS109) due to compensatory mutations in upstream enzymes (ispH and idi) . This demonstrates how genetic context can dramatically influence observed phenotypes when studying cell wall synthesis enzymes.

What are promising unexplored aspects of uppP function in G. diazotrophicus?

Several promising research directions for G. diazotrophicus uppP remain unexplored:

Relationship to Plant Growth Promotion:

  • Investigate whether uppP activity influences the production or secretion of plant growth-promoting compounds

  • Determine if uppP mutations affect the ability of G. diazotrophicus to synthesize phytohormones like indole-3-acetic acid and gibberellins

  • Explore connections between cell wall synthesis and nitrogen fixation efficiency

Role in Plant-Microbe Interactions:

  • Study whether uppP function influences the elicitation of plant defense responses

  • G. diazotrophicus has been shown to trigger defense responses against pathogens like Xanthomonas albilineans

  • Investigate if uppP mutations affect the production of microbe-associated molecular patterns (MAMPs) recognized by plant immune systems

Structural and Functional Analysis:

  • Determine the 3D structure of G. diazotrophicus uppP through X-ray crystallography or cryo-EM

  • Compare with uppP enzymes from other bacteria to identify unique features

  • Conduct site-directed mutagenesis to identify catalytic residues and regulatory domains

How might uppP function contribute to G. diazotrophicus adaptation to different plant hosts?

G. diazotrophicus can colonize diverse plant hosts beyond its original sugarcane host. Understanding uppP's role in this adaptability offers interesting research opportunities:

Host-Specific Adaptation Mechanisms:

  • Investigate whether uppP expression or activity varies when G. diazotrophicus colonizes different plant species

  • Examine if cell wall modifications mediated by uppP influence adhesion to different plant tissues

  • Study whether environmental factors in different plant microenvironments affect uppP function

Colonization Strategy:

  • Compare uppP activity during different stages of colonization (rhizosphere attachment, entry, endophytic establishment)

  • Analyze how uppP contributes to transitions between biofilm and planktonic lifestyles during colonization

  • Investigate if uppP function relates to the filamentous morphology observed in some plant tissues

Experimental Approaches:

  • Create reporter strains with uppP promoter fused to fluorescent proteins to monitor expression in different plant hosts

  • Develop conditional uppP mutants to study its role at different colonization stages

  • Use comparative transcriptomics to identify host-specific regulation of uppP and related cell wall synthesis genes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.