Recombinant Gluconacetobacter diazotrophicus UPF0060 membrane protein GDI3492/Gdia_2889 (GDI3492, Gdia_2889)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If a specific tag is required, please inform us, and we will prioritize its implementation.
Synonyms
GDI3492; Gdia_2889; UPF0060 membrane protein GDI3492/Gdia_2889
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5)
Target Names
GDI3492
Target Protein Sequence
MRMLLGSFAVYAAAALCEIGGCYAWWCWRRAGAGAWVLLPGMASLALFGWLLTLVDSDTA GRTFAAYGGIYIVGAIVWLRLVEGRPVTLRDAAGVAICLAGAAIILSAGRGAER
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is known about Gluconacetobacter diazotrophicus as a host organism?

Gluconacetobacter diazotrophicus is an endophytic microorganism belonging to the α-proteobacteria with the capacity to fix molecular nitrogen. Originally isolated from Brazilian sugarcane varieties, it has subsequently been found in sugarcane cultivars in Mexico, Cuba, and Australia, as well as in coffee and pineapple crops . G. diazotrophicus functions as an endophyte in these plants and has been suggested to be a primary diazotroph contributing to high levels of biological nitrogen fixation in sugarcane plants .

G. diazotrophicus requires microaerobic conditions for diazotrophic growth and establishes associations with various plants beyond sugarcane, including important crops such as wheat and coffee. This characteristic gives it greater potential than free-living diazotrophs for expanded use with crops that traditionally require significant quantities of industrial fertilizers .

How can I design a basic expression and purification protocol for this protein?

The production of GDI3492/Gdia_2889 recombinant protein typically follows standard recombinant protein expression protocols:

  • Construct an expression vector: Clone the GDI3492 gene into an appropriate expression vector with a 10xHis-tag at the N-terminus.

  • Transform into a suitable host: E. coli is a common expression system for this protein.

  • Induce protein expression: Use optimal conditions for the expression system chosen.

  • Cell lysis: Disrupt cells to release the protein.

  • Purification: Utilize immobilized metal affinity chromatography (IMAC) to capture the His-tagged protein.

  • Quality assessment: Verify protein purity by SDS-PAGE.

For storage, the purified protein can be maintained in Tris/PBS-based buffer with 6% trehalose at pH 8.0. Storage at -20°C/-80°C is recommended, with aliquoting to avoid repeated freeze-thaw cycles. Lyophilization may extend shelf life to approximately 12 months, while liquid formulations typically remain stable for about 6 months at -20°C/-80°C .

How can I optimize expression conditions for GDI3492/Gdia_2889 using Design of Experiments (DoE)?

Optimization of expression conditions for membrane proteins like GDI3492/Gdia_2889 benefits significantly from Design of Experiments (DoE) methodologies rather than the traditional one-factor-at-a-time approach. A methodological approach would include:

  • Identify key factors: Determine influential parameters such as temperature, inducer concentration, expression time, media composition, and host strain.

  • Select appropriate DoE method: For initial screening, use fractional factorial designs to identify significant factors. For optimization, employ response surface methodology (RSM).

  • Experimental design matrix: Create a matrix of experiments with different factor combinations:

ExperimentTemperature (°C)IPTG Concentration (mM)Expression Time (h)Media TypeHost Strain
1180.116LBBL21(DE3)
2181.04TBRosetta
3300.14TBBL21(DE3)
4301.016LBRosetta
  • Response measurement: Quantify protein yield and quality (solubility, activity) for each experiment.

  • Statistical analysis: Use software packages to analyze results, identify significant factors and interactions, and generate predictive models.

  • Validation: Perform validation experiments at the predicted optimal conditions.

This approach allows for identifying not only main effects but also interaction effects between factors, thereby achieving optimal expression conditions with fewer experiments and resources .

What are the key considerations for functional characterization of this membrane protein?

Functional characterization of the UPF0060 membrane protein requires careful experimental design considering its nature as a multi-pass membrane protein:

  • Protein solubilization: Select appropriate detergents (e.g., DDM, LMNG) or lipid nanodiscs to maintain the protein in a native-like environment.

  • Structural analysis options:

    • Circular dichroism (CD) to assess secondary structure content

    • Nuclear magnetic resonance (NMR) for detailed structural information

    • X-ray crystallography if crystallization is possible

    • Cryo-electron microscopy for higher-resolution structural information

  • Interaction studies:

    • Pull-down assays with His-tagged protein to identify interaction partners

    • Biolayer interferometry or surface plasmon resonance for binding kinetics

    • Cross-linking coupled with mass spectrometry to map protein-protein interactions

  • Functional assays:

    • Given the location in G. diazotrophicus, investigate potential roles in:

      • Membrane transport activities

      • Signal transduction

      • Nitrogen fixation pathways

  • Data analysis framework:

    • Compare results with known UPF0060 family members from other organisms

    • Integrate findings with genomic context data and protein sequence analyses

When designing these experiments, it's critical to include appropriate controls and validate findings using complementary techniques, as membrane proteins often present technical challenges in maintaining their native conformations during isolation and analysis .

How might GDI3492/Gdia_2889 be involved in nitrogen fixation processes?

While direct evidence linking GDI3492/Gdia_2889 to nitrogen fixation is limited in the provided search results, we can formulate hypotheses based on its context in G. diazotrophicus:

  • Membrane localization significance: As a multi-pass membrane protein, GDI3492/Gdia_2889 could potentially be involved in:

    • Transport of molecules related to nitrogen metabolism

    • Signal transduction related to nitrogen status sensing

    • Maintaining membrane integrity under microaerobic nitrogen-fixing conditions

  • Relationship to known nitrogen fixation components: G. diazotrophicus contains several genes related to nitrogen fixation and regulation, including three PII-like proteins (GlnB, GlnK1, GlnK2) that control nitrogen fixation in response to ammonium availability . Experimental approaches to investigate potential relationships include:

    • Co-immunoprecipitation with known nitrogen fixation proteins

    • Comparative transcriptomics under nitrogen-fixing vs. non-fixing conditions

    • Targeted gene knockouts followed by phenotypic analysis

  • Fitness under diazotrophic conditions: Research indicates G. diazotrophicus requires microaerobic conditions for diazotrophic growth . Experimental designs to test GDI3492/Gdia_2889's role could include:

    • Growth analysis of GDI3492 knockout strains under various oxygen levels

    • Nitrogenase activity assays in the presence/absence of functional GDI3492

    • Protein expression profiling under different nitrogen availability conditions

To investigate these hypotheses, researchers would need to design controlled experiments comparing wild-type and mutant strains under various growth conditions, with careful measurement of nitrogen fixation rates and related metabolic parameters .

How can I design experiments to determine if GDI3492/Gdia_2889 interacts with nitrogen regulation proteins?

To investigate potential interactions between GDI3492/Gdia_2889 and nitrogen regulation proteins such as the PII proteins (GlnB, GlnK1, GlnK2), consider the following experimental design:

  • In vivo approaches:

    • Bacterial two-hybrid assay: Clone GDI3492 and suspected interaction partners into appropriate vectors, transform into reporter strain, and measure interaction-dependent reporter activity.

    • Co-immunoprecipitation: Express tagged versions of GDI3492 and potential partners, perform pull-downs, and identify co-precipitated proteins by Western blotting or mass spectrometry.

    • Cross-linking coupled with immunoprecipitation: Use membrane-permeable cross-linkers to stabilize protein complexes in vivo before isolation.

  • In vitro approaches:

    • Surface plasmon resonance (SPR): Immobilize purified GDI3492 on a sensor chip and flow purified nitrogen regulation proteins over the surface to measure binding kinetics.

    • Microscale thermophoresis (MST): Label either GDI3492 or the potential partner and measure interaction-dependent changes in thermophoretic mobility.

  • Confirmatory functional studies:

    • Gene knockout/complementation: Create GDI3492 knockout strains, complement with wild-type or mutated versions, and assess effects on nitrogen regulation.

    • Site-directed mutagenesis: Mutate specific residues in GDI3492 predicted to be involved in protein-protein interactions and assess functional consequences.

  • Data analysis considerations:

    • Account for membrane protein constraints in experimental design

    • Include appropriate controls (non-interacting proteins, buffer controls)

    • Perform replicate experiments for statistical validation

    • Consider both direct and indirect interaction possibilities

This multi-method approach provides robust evidence for protein-protein interactions while addressing the specific challenges associated with membrane protein biochemistry .

How can transposon sequencing be used to investigate the role of GDI3492/Gdia_2889 in G. diazotrophicus?

Transposon sequencing (Tn-seq) is a powerful approach to investigate gene function through fitness measurements. Based on the methodology described for G. diazotrophicus in the literature , a Tn-seq approach to study GDI3492/Gdia_2889 would include:

  • Library generation:

    • Create a saturated transposon insertion library in G. diazotrophicus

    • Ensure sufficient coverage across the GDI3492 gene and surrounding genomic regions

    • Verify library quality through initial sequencing

  • Experimental conditions:

    • Culture the library under various relevant conditions:

      • Diazotrophic growth (microaerobic, no fixed nitrogen)

      • Non-diazotrophic growth (with ammonium)

      • Different carbon sources (e.g., sucrose vs. other sugars)

      • Various oxygen concentrations

    • Allow sufficient generations of growth (4-7 generations as described in the literature)

  • Sample analysis:

    • Extract genomic DNA from each condition

    • Amplify transposon-genome junctions

    • Perform high-throughput sequencing

    • Map reads to reference genome

  • Data analysis and interpretation:

    • Calculate fitness scores for GDI3492 and all other genes

    • Compare fitness effects across different conditions

    • Identify condition-specific fitness defects

    • Cluster genes with similar fitness profiles

    • Place GDI3492 in a functional context based on genes with similar profiles

The results would reveal whether GDI3492/Gdia_2889 has a fitness effect under specific conditions, particularly those related to nitrogen fixation and microaerobic growth. This would provide insights into its functional role and biological importance .

What are the best approaches for analyzing structural features of GDI3492/Gdia_2889 and their functional implications?

Analyzing structural features of GDI3492/Gdia_2889 requires specialized approaches for membrane proteins:

  • Computational structure prediction:

    • Hydropathy analysis: Identify transmembrane regions using algorithms like TMHMM or Phobius

    • Homology modeling: Generate structural models based on related proteins with known structures

    • Ab initio modeling: For unique regions with no homology to known structures

    • Molecular dynamics simulations: Explore protein behavior in a membrane environment

  • Experimental structure determination:

    • X-ray crystallography: Requires successful crystallization, which is challenging for membrane proteins

      • Detergent screening is critical

      • Consider lipidic cubic phase crystallization

    • Cryo-electron microscopy (cryo-EM): Increasingly powerful for membrane proteins

    • Nuclear magnetic resonance (NMR): For specific domains or the entire protein if size permits

  • Structure-function relationship analysis:

    • Site-directed mutagenesis: Target conserved residues identified through sequence alignment of UPF0060 family members

    • Chimeric proteins: Exchange domains with homologous proteins to determine functional regions

    • Disulfide cross-linking: To validate predicted proximity of structural elements

  • Data integration framework:

Analysis LevelMethodsExpected OutcomesIntegration Approach
Primary StructureSequence analysis, Conservation mappingIdentification of key residuesHighlight on 3D models
Secondary StructureCD spectroscopy, Prediction algorithmsHelical content, topologyRefine computational models
Tertiary StructureX-ray/Cryo-EM/NMR3D coordinatesMolecular dynamics validation
Functional ElementsMutagenesis, Activity assaysStructure-function correlationsPathway/network positioning
  • Validation experiments:

    • Test structural predictions through targeted biochemical experiments

    • Correlate structural features with observed phenotypes in mutant strains

    • Consider evolutionary conservation as supportive evidence for structural importance

This integrated approach allows researchers to move from sequence to structure to function, establishing a comprehensive understanding of GDI3492/Gdia_2889's role in the biology of G. diazotrophicus .

What are the major challenges in studying G. diazotrophicus membrane proteins and how can they be addressed?

Research on G. diazotrophicus membrane proteins like GDI3492/Gdia_2889 faces several significant challenges:

  • Expression and purification difficulties:

    • Challenge: Membrane proteins often express poorly and may be toxic to host cells

    • Solution approach:

      • Use specialized expression strains (C41/C43)

      • Employ inducible promoters with tight regulation

      • Test fusion partners that enhance folding and solubility

      • Optimize growth temperature (typically lower for membrane proteins)

      • Consider cell-free expression systems

  • Maintaining native structure:

    • Challenge: Detergent extraction can disrupt native conformation

    • Solution approach:

      • Screen multiple detergents systematically

      • Use lipid nanodiscs or styrene maleic acid lipid particles (SMALPs)

      • Apply gentle solubilization protocols

      • Include stabilizing ligands during purification

  • Microaerobic culture requirements:

    • Challenge: G. diazotrophicus requires specific oxygen conditions for diazotrophic growth

    • Solution approach:

      • Design bioreactors with precise oxygen control

      • Utilize closed reactor systems with defined gas mixtures (e.g., 2.5% oxygen)

      • Monitor dissolved oxygen continuously

      • Standardize culture conditions for reproducibility

  • Functional characterization:

    • Challenge: Unknown function makes assay development difficult

    • Solution approach:

      • Use comparative genomics to identify potential functions

      • Perform systematic phenotypic analysis of mutants

      • Employ untargeted metabolomics to identify affected pathways

      • Leverage transposon sequencing data for fitness effects under various conditions

  • Data integration:

    • Challenge: Connecting molecular features to physiological roles

    • Solution approach:

      • Develop comprehensive data integration frameworks

      • Apply systems biology approaches

      • Create predictive models of membrane protein function

      • Use evolutionary analysis to identify conserved features

Addressing these challenges requires multidisciplinary approaches and often necessitates developing new methodologies specifically tailored to the unique properties of bacterial membrane proteins .

How can I design experiments to investigate the potential role of GDI3492/Gdia_2889 in plant-microbe interactions?

Given that G. diazotrophicus functions as an endophyte in plants like sugarcane, investigating GDI3492/Gdia_2889's role in plant-microbe interactions requires carefully designed experiments:

  • Gene knockout and complementation studies:

    • Generate targeted GDI3492 deletion mutants

    • Create complemented strains with wild-type and modified variants

    • Design positive controls (known colonization factors) and negative controls

  • Plant colonization experiments:

    • Experimental design:

      • Inoculate sterile plant seedlings with wild-type and mutant strains

      • Maintain plants under controlled conditions

      • Harvest at multiple time points (early, mid, late colonization)

    • Analysis methods:

      • Quantify bacterial populations in different plant tissues

      • Use fluorescently labeled strains for microscopy

      • Perform competitive colonization assays (wild-type vs. mutant)

  • Transcriptomic analysis:

    • Compare gene expression profiles:

      • Wild-type vs. GDI3492 mutant during plant colonization

      • Free-living vs. plant-associated bacteria

      • Different plant tissues and colonization stages

    • Identify co-regulated genes that may function in the same pathway

  • Biochemical interaction studies:

    • Investigate if GDI3492/Gdia_2889 interacts with:

      • Plant-derived compounds (sugars, organic acids, etc.)

      • Plant membrane proteins

      • Bacterial proteins involved in colonization

  • Phenotypic assessment matrix:

ParameterMeasurement MethodWild-typeΔGDI3492Complemented
Root colonizationCFU counts, microscopyBaselineCompareRecovery?
Stem colonizationCFU counts, microscopyBaselineCompareRecovery?
N-fixation in planta15N incorporationBaselineCompareRecovery?
Plant growth promotionBiomass, N contentBaselineCompareRecovery?
Stress responseSurvival under various stressesBaselineCompareRecovery?
  • Data analysis considerations:

    • Account for biological variability in plant systems

    • Perform adequate biological and technical replicates

    • Use appropriate statistical methods for complex datasets

    • Consider potential pleiotropic effects of gene deletion

This comprehensive approach would provide insights into whether GDI3492/Gdia_2889 plays a direct role in plant-microbe interactions or whether its functions are primarily related to bacterial physiology that indirectly affects colonization ability .

How can I integrate multiple datasets to build a comprehensive functional model of GDI3492/Gdia_2889?

Building a comprehensive functional model for GDI3492/Gdia_2889 requires integration of diverse experimental data and computational predictions:

  • Multi-omics data integration framework:

    • Genomic data: Analyze gene neighborhood, evolutionary conservation, and synteny

    • Transcriptomic data: Identify co-expressed genes under various conditions

    • Proteomic data: Map protein-protein interactions and post-translational modifications

    • Metabolomic data: Connect to metabolic pathways affected by protein function

    • Phenomic data: Link molecular features to observable phenotypes

  • Structural-functional relationship modeling:

    • Map functional data onto structural predictions/models

    • Identify critical residues for specific functions

    • Predict ligand binding sites or protein-protein interaction interfaces

    • Use evolutionary conservation as a guide for functional importance

  • Network analysis approach:

    • Place GDI3492/Gdia_2889 in protein interaction networks

    • Identify functional modules containing the protein

    • Apply graph theory to predict functional relationships

    • Use guilt-by-association principles to infer function

  • Comparative genomics perspective:

    • Compare with homologs in other nitrogen-fixing bacteria

    • Analyze presence/absence patterns across related species

    • Identify co-evolution with other genes/proteins

  • Integration methodology:

    • Use machine learning approaches to find patterns across datasets

    • Develop weighted scoring systems to prioritize functional hypotheses

    • Create visual representations of integrated data

    • Implement Bayesian networks to model causal relationships

  • Validation strategy:

    • Design targeted experiments to test predictions from integrated model

    • Iteratively refine the model based on new experimental data

    • Assess model robustness through cross-validation approaches

This integrative approach transforms disparate data points into a coherent functional hypothesis that can guide further experimental investigation of GDI3492/Gdia_2889's role in G. diazotrophicus biology .

What emerging technologies show promise for advancing research on bacterial membrane proteins like GDI3492/Gdia_2889?

Several cutting-edge technologies are poised to transform research on bacterial membrane proteins like GDI3492/Gdia_2889:

  • Advanced structural biology approaches:

    • Single-particle cryo-electron microscopy: Increasingly capable of high-resolution structures of membrane proteins without crystallization

    • Micro-electron diffraction (MicroED): Allows structure determination from nanocrystals

    • Integrative structural biology: Combines multiple experimental methods with computational modeling

  • Membrane protein engineering technologies:

    • Directed evolution platforms: Develop variants with improved stability/expression

    • Nanobody technology: Generate crystallization chaperones and conformational stabilizers

    • Synthetic biological circuits: Control membrane protein expression in response to specific signals

  • Live-cell imaging and single-molecule techniques:

    • Super-resolution microscopy: Visualize membrane protein organization in bacterial cells

    • Single-molecule tracking: Follow membrane protein dynamics in real-time

    • Correlative light and electron microscopy (CLEM): Connect functional data with ultrastructural context

  • High-throughput functional screening:

    • Microfluidic platforms: Test thousands of conditions simultaneously

    • CRISPR-based screens: Systematically interrogate genetic interactions

    • Activity-based protein profiling: Identify substrates and interaction partners

  • Artificial intelligence applications:

    • AlphaFold and RoseTTAFold: Predict membrane protein structures with increasing accuracy

    • Machine learning for function prediction: Infer functional properties from sequence and structure

    • Automated experimental design: Optimize conditions for membrane protein expression and purification

  • Synthetic biology approaches:

    • Minimal cell systems: Study membrane proteins in simplified cellular contexts

    • Cell-free expression systems: Produce membrane proteins in controlled environments

    • Bioorthogonal chemistry: Label and modify membrane proteins in living cells

These emerging technologies promise to overcome many traditional challenges in membrane protein research, potentially accelerating our understanding of proteins like GDI3492/Gdia_2889 and their roles in bacterial physiology and plant-microbe interactions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.