Recombinant Gluconobacter oxydans ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Genomic and Functional Context

In G. oxydans, ATP synthase genes are organized into two clusters:

  • Cluster I (GOX1110–1113): Encodes membrane-bound subunits (including atpB) .

  • Cluster II (GOX1310–1314): Encodes hydrophilic subunits (F₁ sector) .

The F₁F₀-ATP synthase operates under a limited proton gradient due to the absence of proton-translocating complexes like NADH dehydrogenase I and cytochrome c oxidase . This unique setup minimizes energy waste, aligning with G. oxydans’ adaptation to nutrient-rich environments .

mRNA Decay and Expression Stability

The mRNA encoding atpB has an exceptionally short half-life, comparable to other central metabolic genes in G. oxydans . This rapid turnover may limit metabolic engineering efforts to improve biomass yield, as sustained expression of ATP synthase is critical for energy production .

GenemRNA Half-LifeFunctional Impact
atpBVery short (~minutes)Limits steady ATP synthesis under stress

Regulatory Mechanisms

While no direct regulators of atpB have been identified, the FNR-type regulator GoxR (GOX0974) modulates oxygen-dependent genes, including cytochrome bd oxidase (cioAB) and the pnt operon . Indirect regulation via GoxR may influence ATP synthase activity under varying oxygen conditions .

Applications and Availability

Recombinant atpB is commercially available for research, including:

  • ELISA Kits: For detecting atpB in G. oxydans or engineered systems .

  • Structural Studies: His-tagged variants enable crystallization or biochemical assays .

Key Suppliers

ProductCatalog NumberQuantityPrice
Recombinant atpB (His-tag)RFL2797GFLyophilized~$1,598/50 µg
ELISA KitCSB-CF685891GGU50 µg~$1,598

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; GOX1113; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans)
Target Names
atpB
Target Protein Sequence
MAAGSTIDALGQFELHPVLGHLGEALRFSQSPLFMLIAAAVVLVFLYVGMRPAAVVPGRL QAAAEISYDFVHDLAVSTIGENGATFFPFVFAIFFFILAGNYLGLLPFSFTYTSHIAVTF GLAIMVFIISILASIRFQGVGFLKHFLPAGTPVWLAPLLVPIEIISFLSRPVSLSIRLFA NMVAGHVLLEVFAGFTIMLAGLGAFGHVLAIAPIAINIALTALELLVGVLQAYVFAILTC IYLREAVAH
Uniprot No.

Target Background

Function
ATP synthase subunit a (atpB) is a key component of the proton channel and plays a direct role in the translocation of protons across the membrane.
Database Links

KEGG: gox:GOX1113

STRING: 290633.GOX1113

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of ATP synthase subunit a (atpB) in Gluconobacter oxydans?

ATP synthase subunit a (atpB) in G. oxydans forms a critical component of the membrane-embedded Fo sector of ATP synthase. It creates part of the proton channel that facilitates proton movement from the periplasmic space to the c-ring, driving the rotary mechanism of ATP synthesis. This function is particularly important in G. oxydans due to its unique metabolism characterized by incomplete oxidation of substrates and the absence of a complete tricarboxylic acid (TCA) cycle .

The ATP synthase in G. oxydans is likely responsible for ATP-proton motive force interconversion under most conditions, as indicated by metabolic studies. Notably, the mRNA encoding ATP synthase components in G. oxydans has unusually short half-lives compared to other bacteria, suggesting tight regulation of this crucial energy-transducing complex .

How does the structure of G. oxydans ATP synthase compare to other bacterial F-type ATP synthases?

  • A membrane-extrinsic F1 sector containing the catalytic sites where ATP is synthesized from ADP and inorganic phosphate

  • A membrane-embedded Fo sector featuring the ion channel and c-ring rotor

Unlike some bacterial ATP synthases that can utilize Na+ as the coupling ion (as seen in Fusobacterium nucleatum ), G. oxydans ATP synthase likely primarily uses H+ for energy transduction, reflecting its adaptation to acidic environments where it naturally thrives .

FeatureG. oxydans ATP SynthaseTypical Bacterial ATP SynthaseNa+-Coupled ATP Synthase
Preferred coupling ionH+H+Na+
mRNA half-lifeVery shortLongerVariable
Environmental adaptationAcidophilicNeutrophilicOften alkaliphilic
c-ring compositionNot characterizedc8-c15Often c11
ATP synthesis pH optimumAcidic rangeNeutral rangeAlkaline range

What are the challenges in expressing recombinant G. oxydans atpB?

Expressing recombinant G. oxydans atpB presents several methodological challenges:

  • Membrane protein expression issues: As a highly hydrophobic integral membrane protein, atpB has a tendency to aggregate or misfold when overexpressed in heterologous systems.

  • Proper membrane insertion: Ensuring correct orientation and insertion into the membrane is critical for functional studies.

  • Host compatibility: The unique G. oxydans codon usage and potential requirements for specific chaperones may necessitate optimization for expression in common laboratory hosts like E. coli.

  • Functional reconstitution: After purification, reconstituting functional atpB into liposomes or nanodiscs requires careful optimization of lipid composition and protein-to-lipid ratios.

  • Structural integrity assessment: Verifying that the recombinant protein maintains its native structure and ion channel functionality poses significant analytical challenges.

These challenges are similar to those faced when working with other membrane proteins like the ATP synthase components from other organisms, though G. oxydans' unique physiology may introduce additional complications .

What experimental methods are commonly used to study G. oxydans ATP synthase activity?

Several experimental approaches can be employed to investigate the activity of G. oxydans ATP synthase:

  • ATP synthesis assays: Measuring ATP production in inverted membrane vesicles or reconstituted proteoliposomes using luciferase-based assays.

  • Proton pumping measurements: Using pH-sensitive fluorescent dyes to monitor proton translocation across membranes.

  • ATPase activity assays: Quantifying inorganic phosphate release during ATP hydrolysis using colorimetric methods.

  • Inhibitor studies: Employing specific ATP synthase inhibitors to assess sensitivity and binding characteristics.

  • Site-directed mutagenesis: Creating specific mutations in atpB to identify key residues involved in proton translocation.

  • Membrane potential measurements: Using potential-sensitive fluorescent dyes to monitor membrane potential generation.

The very short mRNA half-lives of ATP synthase components in G. oxydans necessitate careful timing in experimental design to capture the dynamic regulation of this enzyme complex .

How does the atpB gene expression correlate with the unique metabolism of G. oxydans?

The expression pattern of atpB in G. oxydans is intricately linked to its distinctive metabolism characterized by incomplete oxidation. Research indicates that ATP synthase components in G. oxydans have unusually short mRNA half-lives, suggesting rapid turnover and tight regulation in response to metabolic demands .

This rapid regulation may be critical because G. oxydans:

  • Oxidizes substrates incompletely with membrane-bound dehydrogenases

  • Secretes oxidation products into the medium rather than utilizing them for biomass production

  • Lacks a complete TCA cycle and functional glycolysis

  • Exhibits low biomass yield on substrates

These metabolic features suggest that ATP synthase plays a particularly crucial role in energy acquisition, as the organism likely relies heavily on oxidative phosphorylation despite its incomplete oxidation of substrates .

How does the short mRNA half-life of ATP synthase components impact energy metabolism in G. oxydans?

The remarkably short mRNA half-lives of ATP synthase components in G. oxydans represent a unique feature with significant implications for energy metabolism. Analysis of global mRNA decay in G. oxydans revealed that H+-ATP synthase transcripts have particularly brief half-lives compared to other bacteria .

This rapid turnover likely enables:

  • Fast adaptation to changing environmental conditions

  • Precise control of ATP synthesis capacity in response to substrate availability

  • Energy conservation during shifts in metabolism

  • Coordination between membrane-bound oxidation and cytoplasmic ATP requirements

The short half-life may represent an evolutionary adaptation to G. oxydans' ecological niche, where it encounters varying substrates and must rapidly adjust its energy production machinery. This feature is notably in contrast to mRNA decay patterns observed in other bacteria and could be a limiting factor when attempting to improve biomass yield through metabolic engineering .

What structural adaptations might enable G. oxydans ATP synthase to function optimally in acidic environments?

G. oxydans thrives in acidic environments, requiring its ATP synthase to function efficiently under these conditions. While specific structural information for G. oxydans ATP synthase is not available in the search results, potential adaptations might include:

  • Modified proton-binding sites: Altered pKa values of key residues in atpB to function optimally at lower pH

  • Enhanced subunit stability: Additional salt bridges or hydrophobic interactions to maintain structural integrity under acidic conditions

  • Specialized interface regions: Modifications at the interface between atpB and the c-ring to maintain efficient proton transfer at low pH

  • Proton pathway adaptations: Structural features that prevent proton leakage at high proton concentration gradients

Understanding these adaptations would require structural studies using techniques like cryo-electron microscopy or X-ray crystallography, similar to those performed for other ATP synthases .

How might recombinant atpB be used to investigate the ion specificity of G. oxydans ATP synthase?

Recombinant atpB provides a valuable tool for investigating whether G. oxydans ATP synthase primarily utilizes H+ or potentially Na+ for its function. The search results reveal that some bacteria like Fusobacterium nucleatum employ Na+-coupled ATP synthases with specific ion-binding motifs in their c-rings .

To investigate ion specificity, researchers could:

  • Generate chimeric constructs by replacing ion-binding residues in atpB with those from known Na+-specific ATP synthases

  • Perform in vitro reconstitution experiments with purified recombinant atpB and other ATP synthase components to measure activity with different ion gradients

  • Use site-directed mutagenesis to modify potential ion-binding sites and analyze the impact on function

  • Employ isotope labeling to track ion movement through the atpB channel

The crystallographic studies of Na+-coupled ATP synthases show that Na+ ions are coordinated by specific amino acid residues and water molecules, creating a characteristic binding motif that could be compared with G. oxydans atpB sequence to predict ion specificity .

What genetic engineering approaches could modify atpB to improve biomass yield in G. oxydans?

G. oxydans naturally exhibits low biomass yield due to its incomplete oxidation metabolism . Modifying atpB could potentially enhance energy conservation and improve biomass yield through several approaches:

  • Optimization of proton translocation efficiency: Site-directed mutagenesis to reduce proton leakage and improve the ATP/H+ ratio

  • Expression level modification: Adjusting atpB expression to better coordinate with carbon flux through central metabolism

  • Chimeric protein design: Creating fusion proteins incorporating elements from ATP synthases of organisms with higher biomass yields

These modifications should be integrated with broader metabolic engineering strategies. Previous research has shown that completing the TCA cycle by introducing succinate dehydrogenase and succinyl-CoA synthetase genes significantly improved biomass yield on glucose . Complementing these modifications with optimized ATP synthase components could further enhance energy conservation.

Experimental validation would require:

  • Construction of G. oxydans strains with modified atpB

  • Growth characterization in controlled bioreactors

  • Measurement of ATP synthesis rates and cellular energetics

  • Metabolic flux analysis to determine changes in carbon utilization efficiency

How do the ATP synthase properties correlate with the industrial applications of G. oxydans?

G. oxydans is industrially valuable for oxidative biotransformations, producing compounds like L-sorbose (a vitamin C precursor), dihydroxyacetone, and 6-amino-L-sorbose (a precursor for the antidiabetic drug miglitol) . The ATP synthase properties directly impact these applications in several ways:

  • Energy efficiency: The ATP synthase's efficiency affects the balance between growth and oxidative product formation

  • pH tolerance: The ability of ATP synthase to function across pH ranges determines the operational parameters for industrial fermentations

  • Regulatory responsiveness: The short mRNA half-life of ATP synthase components enables rapid metabolic adjustments during industrial bioprocessing

  • Biomass formation: ATP synthase activity directly impacts cell yield, which affects the economics of industrial processes

Understanding and optimizing ATP synthase function, particularly through engineering of atpB, could lead to improved industrial strains with higher productivity, stability, and reduced production costs .

What is the relationship between atpB mutations and membrane-bound dehydrogenase activity in G. oxydans?

G. oxydans performs incomplete oxidation using numerous membrane-bound dehydrogenases that are critical for industrial applications . The relationship between ATP synthase function (via atpB) and these oxidative enzymes represents an important area for investigation:

  • Energetic coupling: ATP synthase utilizes the proton motive force generated by respiratory chain dehydrogenases

  • Membrane organization: Both ATP synthase and dehydrogenases are integral membrane complexes that must function coordinately within the same membrane environment

  • Regulatory networks: Expression of atpB and membrane-bound dehydrogenases may be co-regulated in response to metabolic demands

Mutations in atpB could affect dehydrogenase function through:

  • Alterations in membrane potential affecting dehydrogenase activity

  • Changes in cellular energetics influencing expression of oxidative enzymes

  • Modified membrane organization affecting the assembly or stability of dehydrogenase complexes

Experimental approaches to investigate these relationships would include creating atpB mutants and assessing their impact on various dehydrogenase activities under different substrate conditions.

How can functional studies of recombinant G. oxydans atpB contribute to understanding bacterial ATP synthase evolution?

Functional characterization of G. oxydans atpB can provide valuable insights into the evolution of bacterial ATP synthases, particularly regarding adaptations to specialized metabolic niches:

  • Acidophilic adaptations: G. oxydans thrives in acidic environments, requiring specific adaptations in its ATP synthase

  • Integration with incomplete oxidation: The ATP synthase must function efficiently despite the organism's unusual carbon metabolism

  • Rapid regulation mechanisms: The unusually short mRNA half-life suggests unique regulatory mechanisms

  • Balance between efficiency and respiration rate: G. oxydans balances incomplete substrate oxidation with energy conservation

Comparative studies between G. oxydans atpB and homologs from bacteria with different metabolic strategies could reveal how ATP synthases have evolved to accommodate diverse ecological niches. This knowledge would contribute to our broader understanding of bioenergetic diversity in bacteria and potentially inform the design of ATP synthases with novel properties for biotechnological applications .

What purification strategies are most effective for recombinant G. oxydans atpB?

Purifying recombinant G. oxydans atpB requires specialized approaches due to its hydrophobic nature and membrane association. Effective strategies include:

  • Detergent selection: Systematic screening of detergents (e.g., DDM, LMNG, or digitonin) to identify those that maintain atpB stability and functionality

  • Affinity purification: Incorporating affinity tags (His-tag, FLAG-tag) at positions that don't interfere with function, similar to approaches used for human ATP5F1B

  • Size exclusion chromatography: To separate properly folded protein from aggregates

  • Lipid reconstitution: Incorporating purified protein into nanodiscs or liposomes to maintain native-like environment

  • Activity verification: Functional assays to confirm that the purified protein retains ion channel activity

The search results indicate that similar approaches have been successful for ATP synthase components from other organisms, including expression in yeast systems .

What analytical techniques can verify the structural integrity of recombinant G. oxydans atpB?

Multiple analytical approaches can be employed to verify the structural integrity of recombinant G. oxydans atpB:

  • Circular dichroism (CD) spectroscopy: To assess secondary structure content and stability

  • Limited proteolysis: To evaluate folding and domain organization

  • Fluorescence spectroscopy: Using intrinsic tryptophan fluorescence or extrinsic probes to monitor conformational changes

  • Cross-linking studies: To identify interaction interfaces with other ATP synthase subunits

  • Cryo-electron microscopy: For structural determination when incorporated into larger ATP synthase complexes

  • Protein thermal shift assays: To evaluate protein stability under various conditions

These methods can be complemented by functional assays that verify the protein's ability to conduct ions and participate in ATP synthesis .

How can researchers address the challenges of functional reconstitution of recombinant G. oxydans atpB?

Functional reconstitution of recombinant G. oxydans atpB presents several challenges that researchers can address through:

  • Optimal lipid composition: Systematically testing different lipid mixtures to identify those supporting atpB function, potentially including lipids extracted from G. oxydans membranes

  • Controlled protein orientation: Developing methods to ensure unidirectional insertion into liposomes

  • Co-reconstitution approaches: Incorporating atpB with other ATP synthase components to reconstruct functional complexes

  • Proton leakage minimization: Optimizing reconstitution protocols to create sealed vesicles capable of maintaining proton gradients

  • Activity verification: Establishing robust assays to confirm ion transport functionality

What emerging technologies could advance our understanding of G. oxydans atpB structure and function?

Several cutting-edge technologies hold promise for advancing our understanding of G. oxydans atpB:

  • Cryo-electron microscopy: For high-resolution structural determination of the complete ATP synthase complex

  • Single-molecule FRET: To study conformational dynamics during proton translocation

  • Molecular dynamics simulations: To model proton movement through the atpB channel

  • Native mass spectrometry: For analyzing subunit interactions and complex assembly

  • In-cell NMR: To study the behavior of atpB in a native-like environment

  • Artificial intelligence approaches: For predicting structure-function relationships and designing optimized variants

These technologies could provide unprecedented insights into how G. oxydans atpB contributes to ATP synthesis and how it has adapted to the organism's unique metabolism and ecological niche .

How might systems biology approaches integrate atpB function with broader metabolic networks in G. oxydans?

Systems biology approaches can provide a holistic understanding of how atpB function integrates with G. oxydans metabolism:

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data to map relationships between ATP synthase expression and metabolic flux

  • Genome-scale metabolic modeling: Incorporating ATP synthase kinetics into metabolic models to predict the effects of genetic modifications

  • Regulatory network mapping: Identifying transcriptional and post-transcriptional regulators controlling atpB expression

  • Flux balance analysis: Quantifying energy flows through different metabolic pathways and their dependence on ATP synthase activity

  • In silico strain design: Computational prediction of optimal atpB modifications to achieve desired phenotypes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.