Recombinant Gluconobacter oxydans Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
crcB; GOX2653; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-144
Protein Length
full length protein
Species
Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans)
Target Names
crcB
Target Protein Sequence
MSFTTCLIVMVGGALGTLARYLVSVAAMPISRFIPWGTILPINALGSFVIGFFGTLTLAD GRYPVSENMRLFVMIGLCGGYTTFSSFSLQTLDLIRNDAWGRASVNVAASVILCIGAVAL GHITADGFNTGAIRIAQTATEEDA
Uniprot No.

Target Background

Function
This protein plays a crucial role in reducing fluoride concentration within cells, thereby mitigating its toxicity.
Database Links

KEGG: gox:GOX2653

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the CrcB homolog relate to the unique metabolism of Gluconobacter oxydans?

G. oxydans possesses a distinctive metabolism characterized by incomplete oxidation of sugars and sugar alcohols in the periplasm, with products released into the growth medium . The bacterium has limited cytoplasmic metabolism due to an incomplete tricarboxylic acid (TCA) cycle and Embden-Meyerhof-Parnas (EMP) pathway .

While the direct relationship between CrcB homolog and G. oxydans' metabolism has not been fully characterized, membrane proteins like CrcB may contribute to maintaining ion homeostasis, which is crucial for the function of membrane-bound dehydrogenases that catalyze the incomplete oxidation processes. Recent research on undefined dehydrogenases in G. oxydans suggests that many membrane proteins previously lacking functional characterization play important roles in maintaining membrane integrity and supporting the periplasmic oxidation processes .

The efficient functioning of membrane proteins is particularly important in G. oxydans because:

  • The bacterium relies heavily on membrane-bound dehydrogenases for substrate oxidation

  • Ion balance across membranes affects the activity of these oxidative enzymes

  • Membrane integrity is essential for the spatial separation of periplasmic and cytoplasmic metabolic pathways

What expression systems are most effective for recombinant production of G. oxydans CrcB homolog?

For heterologous expression of G. oxydans proteins, several systems have proven effective, with considerations specific to membrane proteins like CrcB:

Homologous expression in G. oxydans:
For maintaining native membrane protein folding and function, homologous expression in G. oxydans itself is preferable. Recent research has established several inducible expression systems for G. oxydans:

  • L-arabinose-inducible expression system: The pBBR1MCS-5-based L-arabinose-inducible P<sub>araBAD</sub> promoter system allows up to 480-fold induction with good tunability using 0.1-1% L-arabinose concentrations .

  • TetR-P<sub>tet</sub> system: This system has shown excellent performance in G. oxydans based on de-repression of heterologous target promoters .

  • Optogenetic toolbox: Recent developments include light-controlled gene expression systems for G. oxydans, which allow precise temporal control of expression without chemical inducers .

For membrane proteins like CrcB homolog, expression levels must be carefully controlled to prevent membrane stress, making the tunable L-arabinose-inducible system particularly valuable.

How can gradient promoters be utilized to optimize expression of challenging membrane proteins like CrcB homolog?

Recent research has identified a series of gradient promoters from G. oxydans that can be used to fine-tune expression levels, which is particularly important for membrane proteins like CrcB homolog that may cause toxicity when overexpressed :

PromoterRelative StrengthNotes
P<sub>2703</sub>Strongest (~3x stronger than previously reported strong promoters)May be too strong for membrane proteins
P<sub>2057</sub>Very strongSuccessfully used for SDH overexpression
P<sub>3022</sub>StrongFunctions as shuttle promoter in both E. coli and G. oxydans
P<sub>0943</sub>StrongFunctions as shuttle promoter in both E. coli and G. oxydans
Various weaker promotersGradient strengthsUseful for fine-tuning membrane protein expression

For membrane proteins like CrcB homolog, starting with medium-strength promoters is recommended to balance expression with potential membrane stress. Experimental approach should include:

  • Testing multiple promoters of varying strengths

  • Monitoring growth rates to identify potential toxicity

  • Analyzing protein expression by Western blotting

  • Assessing membrane integrity and stress responses

This gradient promoter approach has been successfully applied to various dehydrogenases in G. oxydans, resulting in significant improvements in product yields through optimized expression levels .

How should experiments be designed to characterize the function of G. oxydans CrcB homolog?

Characterizing the function of CrcB homolog requires a systematic experimental approach combining genetic, biochemical, and physiological methods:

Genetic approach:

  • Gene knockout studies: Create a ΔcrcB deletion mutant using the method described by Link et al., similar to the approach used for mgdH gene deletion in G. oxydans . This involves:

    • Amplifying upstream and downstream regions of crcB

    • Fusion by overlap extension PCR

    • Cloning into pK19mobsacB

    • Performing two recombination events to achieve marker-free deletion

  • Complementation studies: Reintroduce the crcB gene under control of an inducible promoter (e.g., L-arabinose-inducible system) to confirm phenotype restoration.

Biochemical approach:

  • Protein purification and reconstitution: Express CrcB with an affinity tag, purify, and reconstitute in liposomes for ion transport assays.

  • Fluoride ion transport assays: Measure fluoride ion movement across membranes using fluoride-specific electrodes or fluorescent indicators.

Physiological approach:

  • Growth studies under fluoride stress: Compare wild-type and ΔcrcB strains in media containing varying fluoride concentrations.

  • Membrane integrity assays: Assess membrane potential and permeability in wild-type and mutant strains.

Experimental controls should include:

  • Wild-type G. oxydans strain (positive control)

  • ΔcrcB strain (test condition)

  • Complemented ΔcrcB strain (restoration control)

  • Known fluoride channel mutant from another organism (reference control)

What quasi-experimental designs are appropriate for studying CrcB function when complete genetic manipulation is not feasible?

When true experimental conditions cannot be established due to technical or biological constraints, quasi-experimental designs provide valuable alternatives :

Nonequivalent groups design:
This approach can be useful when complete gene knockout is lethal or technically challenging:

  • Use antisense RNA or CRISPR interference to achieve partial knockdown of crcB

  • Compare with wild-type strains under identical conditions

  • Control for confounding variables through careful experimental design and statistical analysis

Regression discontinuity design:
This approach is useful for studying dose-dependent effects:

  • Expose G. oxydans cultures to a gradient of fluoride concentrations

  • Identify threshold concentrations where growth is significantly impacted

  • Compare CrcB expression levels at different points along this continuum

  • Use statistical methods to identify discontinuities that may indicate functional thresholds

Natural experiments:
Take advantage of naturally occurring variations:

  • Compare CrcB sequence and function across different Gluconobacter strains with varying fluoride tolerance

  • Correlate natural sequence variations with functional differences

  • Use environmental isolates from high-fluoride environments to study natural adaptations

These quasi-experimental approaches can provide valuable insights when:

  • Gene knockouts are lethal

  • Transformation efficiency is too low for genetic manipulation

  • Time or resource constraints prevent development of genetic tools

  • Environmental relevance requires studying natural variation

How can transcriptome analysis be applied to understand the role of CrcB homolog in G. oxydans?

Transcriptome analysis using RNA sequencing (RNAseq) provides powerful insights into the expression patterns and regulatory networks involving CrcB homolog:

Primary transcriptome sequencing:
G. oxydans transcriptome analysis has successfully identified 2,449 transcription start sites (TSSs) and characterized promoter motifs, ribosome binding sites, and 5'-UTRs . For CrcB homolog studies, this approach can:

  • Identify the precise TSS of crcB gene

  • Characterize its promoter region and potential regulatory elements

  • Determine if crcB is expressed monocistronically or as part of an operon

  • Detect potential antisense transcripts that might regulate crcB expression

Whole transcriptome analysis:
This approach can reveal:

  • Expression patterns of crcB under different growth conditions

  • Co-expressed genes that may functionally relate to CrcB

  • Transcriptional responses to fluoride stress

  • Regulatory relationships with other membrane components

Methodology for CrcB-focused transcriptome analysis:

  • Culture G. oxydans under varying conditions (different carbon sources, pH values, and fluoride concentrations)

  • Extract RNA using methods optimized for G. oxydans as described in recent transcriptome studies

  • Perform RNAseq using both primary transcriptome and whole transcriptome approaches

  • Analyze differential gene expression focusing on crcB and functionally related genes

  • Validate key findings using RT-qPCR and reporter gene assays

This approach can reveal both the regulatory mechanisms controlling crcB expression and the broader cellular response networks in which CrcB functions, providing a systems-level understanding of its role in G. oxydans physiology.

What advanced structural biology techniques can elucidate the structure-function relationship of G. oxydans CrcB homolog?

Understanding the structure-function relationship of membrane proteins like CrcB homolog requires specialized techniques:

X-ray crystallography challenges and solutions:
Membrane proteins are notoriously difficult to crystallize. For CrcB homolog:

  • Use lipidic cubic phase (LCP) crystallization methods

  • Engineer fusion proteins (e.g., with T4 lysozyme) to increase soluble domains

  • Screen detergents extensively to find optimal conditions for crystal formation

Cryo-electron microscopy (cryo-EM):
Recent advances in cryo-EM make it particularly suitable for membrane proteins like CrcB:

  • Single particle analysis can determine structure at near-atomic resolution

  • Sample preparation requires less protein than crystallography

  • Visualize the protein in a more native-like lipid environment

NMR spectroscopy for dynamics:
While determining the complete structure by NMR may be challenging:

  • Selective isotope labeling can provide information about specific regions

  • Solid-state NMR can analyze the protein in lipid bilayers

  • Solution NMR of isolated domains can provide insights into dynamics

Computational methods:

  • Homology modeling based on known CrcB structures from other organisms

  • Molecular dynamics simulations to study ion movement through the channel

  • Quantum mechanics/molecular mechanics (QM/MM) methods to study the ion selectivity mechanism

Functional validation:
Correlate structural insights with function through:

  • Site-directed mutagenesis of predicted key residues

  • Electrophysiology measurements of ion conductance

  • Fluoride binding assays using isothermal titration calorimetry (ITC)

A multi-technique approach combining these methods would provide the most comprehensive understanding of how CrcB homolog structure enables its proposed function as a fluoride ion channel.

How can researchers address the challenges of G. oxydans growth and genetic manipulation when studying CrcB homolog?

G. oxydans presents several challenges for molecular studies, particularly for membrane proteins like CrcB homolog:

Growth optimization challenges:
G. oxydans exhibits relatively low biomass yields due to its incomplete oxidation metabolism . To improve growth:

  • Metabolic engineering approach: Inactivate membrane-bound glucose dehydrogenase (mgdH) and cytoplasmic glucose dehydrogenase (sgdH) genes, which has been shown to increase biomass yield by up to 271% by redirecting metabolism through cytoplasmic pathways . This table summarizes the improvements:

StrainGrowth rate improvementBiomass yield increase
N44-1 mgdH::kan39%110%
N44-1 ΔmgdH sgdH::kan78%271%
  • Aeration optimization: Ensure 15-30% dissolved oxygen, as higher biomass yields are achieved under controlled aeration conditions in bioreactors compared to shake flasks .

Genetic manipulation strategies:

  • Electroporation optimization: Modify buffer composition and electric field parameters specifically for G. oxydans

  • Two-step homologous recombination: Use the pK19mobsacB system that allows marker-free gene deletions

  • CRISPR/Cas9 adaptation: Optimize codon usage and promoters for G. oxydans

Membrane protein expression considerations:

  • Controlled expression levels: Use tunable promoter systems like the L-arabinose-inducible system

  • Toxicity mitigation: Express toxic membrane proteins in the late exponential or stationary phase

  • Fusion partners: Use periplasmic or secretion signal sequences from native G. oxydans proteins

Practical protocol adaptations:

  • For genomic DNA extraction, use modified protocols accounting for the unique cell wall composition

  • For protein extraction, optimize detergent selection for G. oxydans membrane proteins

  • Develop specialized media formulations that balance growth with expression of recombinant proteins

What are the advanced troubleshooting approaches for functional characterization of CrcB homolog when conventional methods yield contradictory results?

When characterizing membrane proteins like CrcB homolog, contradictory results can arise from various sources. Advanced troubleshooting approaches include:

Resolving expression system artifacts:

  • Compare heterologous vs. homologous expression: Express CrcB in both E. coli and native G. oxydans to distinguish artifacts from true functional characteristics

  • Vary expression levels: Use the gradient promoters identified in G. oxydans to test if function is dependent on expression level

  • Test different fusion tags: Compare N-terminal, C-terminal, and tag-free versions to identify tag interference

Addressing functional assay inconsistencies:

  • Multiple assay validation: If ion transport assays give contradictory results, use complementary methods:

    • Electrophysiology (patch clamp)

    • Fluorescence-based ion flux assays

    • Isotope tracer studies

    • Growth-based functional complementation

  • Control for assay-specific artifacts:

    • pH sensitivity of fluorescent indicators

    • Detergent effects on reconstituted systems

    • Background leak currents in electrophysiology

Resolving phenotypic discrepancies in mutant studies:

  • Polar effects: Check if gene deletion affects downstream genes using RT-qPCR

  • Compensation mechanisms: Analyze transcriptome changes in ΔcrcB strains to identify upregulated compensatory pathways

  • Strain background effects: Test the same mutation in multiple G. oxydans strains

Statistical approaches for contradictory data analysis:

Grading evidence quality:
Apply GRADE methodology (Grading of Recommendations Assessment, Development and Evaluation) to systematically assess the quality of evidence from different experimental approaches :

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.