Recombinant Gluconobacter oxydans Quinoprotein glucose dehydrogenase (gdh)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Gluconobacter oxydans Quinoprotein Glucose Dehydrogenase (GDH)

Recombinant Gluconobacter oxydans Quinoprotein glucose dehydrogenase (GDH) is a pyrroloquinoline quinone (PQQ)-dependent enzyme engineered for high-purity production in heterologous systems like Escherichia coli . This membrane-bound dehydrogenase catalyzes the oxidation of glucose to gluconolactone in the periplasmic space, bypassing ATP generation and enabling incomplete oxidation pathways unique to acetic acid bacteria .

Reaction Mechanism

GDH utilizes a hydride transfer mechanism involving PQQ, as resolved by X-ray crystallography :

  1. PQQ binds to the enzyme’s active site, positioned to interact with glucose.

  2. Glucose oxidation occurs via general base-catalyzed hydride transfer from the C1 position of glucose to PQQ, forming gluconolactone and reduced PQQ .

  3. Electrons are transferred to the respiratory chain, with oxygen as the final acceptor .

Substrate Specificity: Wild-type GDH primarily oxidizes D-glucose, but a single amino acid substitution (His787→Asn) expands activity to maltose .

Industrial Use Cases

  • Lactobionic Acid Production: Recombinant GDH enhances lactose oxidation in Pseudomonas taetrolens, achieving a 17% increase in lactobionic acid productivity (8.70 g/(L·h)) .

  • Metabolic Engineering: Inactivating gdh in G. oxydans shifts glucose metabolism to cytoplasmic pathways, increasing biomass yield by 271% and CO₂ production by 5.5× .

Advantages Over Native Forms

  • Controlled Expression: Recombinant GDH avoids side products like 2-ketogluconate and 2,5-diketogluconate, simplifying downstream processing .

  • Stability: Lyophilized recombinant GDH retains activity for 12 months at -80°C .

Mutational Studies

  • Substituting His787 with Asn broadens substrate specificity to maltose, enabling industrial conversion of disaccharides .

  • Deletion of mgdH (membrane-bound GDH) eliminates periplasmic glucose oxidation, redirecting carbon flux to cytoplasmic pathways and increasing acetate production .

Redox Homeostasis

  • Strains lacking gdh exhibit elevated NAD(P)H levels, impairing growth unless auxiliary NADH dehydrogenases (a-NDH) compensate by reoxidizing cofactors .

Challenges and Future Directions

  • Limitations: Recombinant GDH requires PQQ supplementation in vitro, increasing production costs .

  • Opportunities: Protein engineering to enhance thermostability or cofactor independence could expand industrial applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a useful reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its inclusion in the production process.
Synonyms
gdh; GOX0265; Quinoprotein glucose dehydrogenase; Glucose dehydrogenase [pyrroloquinoline-quinone]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
34-808
Protein Length
Full Length of Mature Protein
Species
Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans)
Target Names
gdh
Target Protein Sequence
AIGGPLYYVILGLALLATAFLSFRRNPAALYLFAVVVFGTVIWELTVVGLDIWALIPRSD IVIILGIWLLLPFVSRQIGGTRTTVLPLAGAVGVAVLALFASLFTDPHDISGDLPTQIAN ASPADPDNVPASEWHAYGRTQAGDRWSPLNQINASNVSNLKVAWHIHTKDMMNSNDPGEA TNEATPIEFNNTLYMCSLHQKLFAVDGATGNVKWVYDPKLQINPGFQHLTCRGVSFHETP ANATDSDGNPAPTDCAKRIILPVNDGRLVEVDADTGKTCSGFGNNGEIDLRVPNQPYTTP GQYEPTSPPVITDKLIIANSAITDNGSVKQASGATQAFDVYTGKRVWVFDASNPDPNQLP DDSHPVFHPNSPNSWIVSSYDRNLNLVYIPMGVGTPDQWGGDRTKDSERFAPGIVALNAD TGKLAWFYQTVHHDLWDMDVPSQPSLVDVTQKDGTLVPAIYAPTKTGDIFVLDRRTGKEI VPAPETPVPQGAAPGDHTSPTQPMSQLTLRPKNPLNDSDIWGGTIFDQMFCSIYFHTLRY EGPFTPPSLKGSLIFPGDLGMFEWGGLAVDPQRQVAFANPISLPFVSQLVPRGPGNPLWP EKDAKGTGGETGLQHNYGIPYAVNLHPFLDPVLLPFGIKMPCRTPPWGYVAGIDLKTNKV VWQHRNGTLRDSMYGSSLPIPLPPIKIGVPSLGGPLSTAGNLGFLTASMDYYIRAYNLTT GKVLWQDRLPAGAQATPITYAINGKQYIVTYAGGHNSFPTRMGDDIIAYALPDQK
Uniprot No.

Target Background

Database Links

KEGG: gox:GOX0265

STRING: 290633.GOX0265

Protein Families
Bacterial PQQ dehydrogenase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein; Periplasmic side.

Q&A

What is Gluconobacter oxydans and what makes its glucose metabolism unique?

Gluconobacter oxydans is an obligatory aerobic acetic acid bacterium notable for its unusual glucose metabolism that primarily occurs in the periplasm. Unlike most microorganisms, G. oxydans oxidizes glucose primarily in the periplasmic space to produce 2-ketogluconate and 2,5-diketogluconate, with gluconate formed as an intermediate. This occurs through membrane-bound dehydrogenases rather than through typical cytoplasmic pathways. Remarkably, less than 10% of glucose is metabolized in the cytoplasm, either after conversion to gluconate or after phosphorylation to glucose-6-phosphate .

The organism possesses only two functional central metabolic pathways: the pentose phosphate pathway (PPP) and the Entner-Doudoroff pathway (EDP). G. oxydans lacks a functional Embden-Meyerhof-Parnas pathway due to the absence of phosphofructokinase, and also has an incomplete citric acid cycle due to the absence of succinate dehydrogenase . This incomplete oxidation system results in a naturally low growth yield but enables the organism to thrive in highly concentrated sugar environments like flowers and fruits, even at low pH values.

What is quinoprotein glucose dehydrogenase (GDH) and what role does it play in G. oxydans?

Quinoprotein glucose dehydrogenase (GDH) is a key enzyme in G. oxydans that catalyzes the oxidation of glucose to gluconate in the periplasmic space. There are two primary forms of GDH in G. oxydans: membrane-bound glucose dehydrogenase (mGDH) and soluble glucose dehydrogenase (sGDH) . These enzymes are classified as quinoproteins because they utilize pyrroloquinoline quinone (PQQ) as a cofactor rather than NAD+ or NADP+ .

The mGDH is particularly crucial as it is responsible for the periplasmic oxidation of glucose, which is a defining characteristic of G. oxydans metabolism. Research has shown that deletion of the mGDH gene (mgdH) alone is sufficient to completely eliminate gluconate formation from glucose, indicating that gluconate accumulation in the medium during the first phase of glucose catabolism is almost exclusively due to mGDH activity, not sGDH . Additionally, mGDH is capable of oxidizing not only glucose but also other substrates such as d-xylose, making it valuable for biotechnological applications .

What is pyrroloquinoline quinone (PQQ) and how does it function in G. oxydans?

Pyrroloquinoline quinone (PQQ) is an organic cofactor that serves as the redox center in various membrane-bound dehydrogenases in G. oxydans. Unlike traditional cofactors like NAD+ or NADP+, PQQ remains tightly bound to the enzyme during catalysis and undergoes reversible reduction and oxidation cycles .

PQQ biosynthesis in G. oxydans involves the pqqABCDE gene cluster, with the pqqA promoter being the only promoter within this cluster. This has been confirmed through reverse transcription-PCR and promoter analysis . Overproduction of PQQ can be achieved by transformation with plasmid-carried pqqA gene or the complete pqqABCDE cluster, offering potential strategies for enhancing the oxidative capabilities of the organism.

What are the different types of glucose dehydrogenases found in G. oxydans and how do they differ?

G. oxydans possesses two main types of glucose dehydrogenases: membrane-bound glucose dehydrogenase (mGDH) and soluble glucose dehydrogenase (sGDH) . These enzymes differ in their cellular localization, substrate specificity, and metabolic consequences:

  • Membrane-bound glucose dehydrogenase (mGDH):

    • Encoded by the mgdH gene (GOX0265 in G. oxydans strain 621H)

    • Located in the periplasmic membrane

    • Primarily responsible for the periplasmic oxidation of glucose to gluconate

    • Essential for the formation of ketogluconates (2-ketogluconate and 2,5-diketogluconate)

    • Has broader substrate specificity, capable of oxidizing various sugars including d-xylose

  • Soluble glucose dehydrogenase (sGDH):

    • Encoded by the sgdH gene (GOX2015 in G. oxydans strain 621H)

    • Located in the cytoplasm

    • Contributes to cytoplasmic glucose oxidation

    • Gluconate formed by sGDH is typically phosphorylated by gluconate kinase and then metabolized in the pentose phosphate or Entner-Doudoroff pathway

    • Does not contribute significantly to the accumulation of extracellular gluconate

The metabolic consequences of these two types of GDH differ significantly. When mGDH is inactivated, glucose metabolism shifts predominantly to cytoplasmic pathways, resulting in increased CO2 production, acetate accumulation, and improved growth rates and yields .

Why is G. oxydans important in biotechnology applications?

G. oxydans has significant value as a biocatalyst in various industrial processes due to its ability to perform regioselective oxidation of sugars and sugar alcohols. This capacity has led to its commercial use in several important biotechnological applications:

  • Vitamin C production: G. oxydans is used in the Reichstein synthesis for vitamin C production, specifically for the regioselective oxidation of d-sorbitol to l-sorbose .

  • Pharmaceutical precursors: The organism is employed in the production of 1-deoxynojirimycin, a precursor of the antidiabetic drug miglitol, by oxidizing N-formyl-1-amino-1-deoxy-d-sorbitol to N-formyl-6-amino-6-deoxy-l-sorbose .

  • Platform chemicals: G. oxydans can produce various platform chemicals such as d-xylonic acid, which has applications as a water reducer and disperser for cement and as a precursor for other valuable compounds .

  • Bioconversion of renewable resources: The organism can convert components of lignocellulosic biomass into value-added products, offering sustainable alternatives to chemical synthesis methods .

These industrial applications typically utilize whole-cell biotransformations with resting G. oxydans cells as catalysts, taking advantage of the organism's natural oxidative capabilities while avoiding the growth limitations associated with its incomplete oxidation metabolism.

How does inactivation of membrane-bound glucose dehydrogenase (mGDH) affect the metabolism and growth of G. oxydans?

Inactivation of membrane-bound glucose dehydrogenase (mGDH) in G. oxydans results in profound metabolic reconfigurations that significantly affect growth parameters and product formation. When the mgdH gene is deleted, glucose is no longer oxidized in the periplasm to gluconate and ketogluconates, but must instead be transported into the cytoplasm for metabolism through the pentose phosphate pathway (PPP) and Entner-Doudoroff pathway (EDP) .

Methodology for mGDH inactivation:
Researchers constructed mutants of G. oxydans strain N44-1 using the following approaches:

  • Single mutant (N44-1 mgdH::kan): The membrane-bound glucose dehydrogenase gene was inactivated using an in-frame deletion method described by Link et al., utilizing the vector pK19 mobsacB. The upstream and downstream regions of mgdH were amplified and fused by overlap extension PCR, with the central part of mgdH (codons 114 to 729) being deleted .

  • Double mutant (N44-1 Δ mgdH sgdH::kan): Both mgdH and sgdH genes were inactivated by first creating the Δ mgdH strain, then disrupting the sgdH gene using plasmid pSUP202 sgdH::kan, which replaced the central part of sgdH (codons 45 to 139) with a kanamycin resistance gene .

Metabolic consequences:

  • Elimination of periplasmic oxidation: Both mutant strains completely consumed glucose but produced neither gluconate nor the secondary products 2-ketogluconate and 2,5-diketogluconate .

  • Increased respiratory activity: Carbon dioxide formation increased dramatically by a factor of 4 in the single mutant and 5.5 in the double mutant, indicating a metabolic shift toward complete oxidation via the PPP rather than the incomplete periplasmic oxidation .

  • Novel product formation: Significant amounts of acetate accumulated in the medium, likely produced through the combined actions of pyruvate decarboxylase and acetaldehyde dehydrogenase. This pathway became active in the gdh mutants but not in the parent strain, presumably because the increased acetyl-CoA production in the mutants could not be processed through the TCA cycle (which is incomplete in G. oxydans) .

  • Growth improvements: Most significantly, the growth yields of the two mutants increased by 110% (single mutant) and 271% (double mutant), while growth rates improved by 39% and 78%, respectively, compared to the parental strain .

These findings demonstrate that the periplasmic oxidation of glucose to gluconate and ketogluconates, while characteristic of G. oxydans, actually has a strong negative impact on the organism's growth efficiency. The improved growth parameters in the mutants offer promising possibilities for enhancing the biotechnological applications of G. oxydans.

What strategies have been employed for overexpression of mGDH in G. oxydans and what were the outcomes?

Overexpression of membrane-bound glucose dehydrogenase (mGDH) in G. oxydans has been strategically employed to enhance the organism's oxidative capabilities, particularly for the production of value-added compounds like d-xylonic acid. The research approach and outcomes reveal significant improvements in production parameters and tolerance to inhibitory compounds.

Methodological approach:
Researchers have developed recombinant strains of G. oxydans with enhanced mGDH expression using the following strategies:

  • Plasmid-based expression: Using mutated plasmids based on pBBR1MCS-5, researchers created the recombinant strain G. oxydans/pBBR-R3510-mGDH .

  • Promoter optimization: While specific details aren't provided in the search results, the successful overexpression suggests optimization of promoter elements to drive high-level expression of the mGDH gene.

Outcomes of mGDH overexpression:

  • Enhanced d-xylonic acid production: The recombinant strain showed significant improvement in d-xylonic acid production parameters compared to the wild-type strain .

  • High production metrics in fed-batch biotransformation:

    • Titer: 588.7 g/L d-xylonic acid

    • Yield: 99.4%

    • Volumetric productivity: 8.66 g/L/h

  • Direct production from lignocellulosic biomass: Without detoxification, the recombinant strain produced 246.4 g/L d-xylonic acid directly from corn stover hydrolysate with a yield of 98.9% and volumetric productivity of 11.2 g/L/h .

  • Enhanced inhibitor tolerance: The G. oxydans/pBBR-R3510-mGDH strain exhibited strong tolerance to typical lignocellulosic hydrolysate inhibitors including formic acid, furfural, and 5-hydroxymethylfurfural, making it particularly valuable for processes using unrefined biomass feedstocks .

This approach demonstrates how targeted overexpression of a key oxidative enzyme can significantly improve the biotransformation capabilities of G. oxydans, particularly for applications involving lignocellulosic feedstocks. The enhanced inhibitor tolerance is especially valuable as it enables direct utilization of hydrolysates without costly detoxification steps, improving the economic feasibility of bioconversion processes.

How does PQQ biosynthesis occur in G. oxydans and how can it be enhanced?

PQQ (pyrroloquinoline quinone) biosynthesis in G. oxydans involves a specific gene cluster and can be enhanced through various genetic engineering approaches. Understanding and improving PQQ production is critical for maximizing the activity of PQQ-dependent dehydrogenases in this organism.

PQQ biosynthesis pathway:
In G. oxydans, PQQ biosynthesis genes are organized in the pqqABCDE gene cluster. Reverse transcription-PCR and promoter analysis have indicated that the pqqA promoter is the only promoter within this gene cluster, suggesting that the entire cluster is transcribed as a single operon . This differs from some other PQQ-producing bacteria that have additional genes like pqqF.

Methodological approaches to study PQQ biosynthesis:

  • Promoter analysis: Using reverse transcription-PCR to identify active promoters within the pqqABCDE gene cluster .

  • Gene disruption: Creating a PQQ-deficient mutant by site-directed disruption of the pqqA gene, allowing researchers to study the physiological consequences of PQQ deficiency .

  • Transposon mutagenesis: Using Tn5 transposon mutagenesis to identify additional genes involved in PQQ biosynthesis, such as the tldD gene which shows homology to the Escherichia coli tldD gene encoding a peptidase .

Strategies to enhance PQQ production:

  • Overexpression of pqqA: Transformation with a plasmid carrying the pqqA gene resulted in PQQ overproduction, indicating that this gene may be a limiting factor in PQQ biosynthesis .

  • Overexpression of complete pqqABCDE cluster: Transformation with the entire pqqABCDE cluster also enhanced PQQ production, providing a more comprehensive approach to boosting biosynthesis capacity .

  • Identification of auxiliary factors: Research has identified the tldD gene as potentially involved in PQQ biosynthesis in G. oxydans, possibly with a similar function to the pqqF genes found in other PQQ-synthesizing bacteria. Understanding and optimizing such auxiliary factors could further enhance PQQ production .

The physiological importance of PQQ in G. oxydans is underscored by the finding that PQQ-deficient mutants cannot grow with d-mannitol, d-glucose, or glycerol as the sole energy source, though they can still grow with d-gluconate . This confirms the critical role of PQQ-dependent membrane-bound dehydrogenases in G. oxydans metabolism and highlights the importance of optimizing PQQ biosynthesis for biotechnological applications.

What experimental approaches can be used to study the periplasmic versus cytoplasmic oxidation pathways in G. oxydans?

Understanding the distinct contributions of periplasmic and cytoplasmic oxidation pathways in G. oxydans requires sophisticated experimental approaches that can delineate these spatially separated metabolic processes.

Genetic manipulation approaches:

  • Targeted gene deletion: Researchers have used site-directed mutagenesis to create specific gene knockouts, such as:

    • Deletion of mgdH (encoding membrane-bound glucose dehydrogenase) to eliminate periplasmic glucose oxidation

    • Deletion of sgdH (encoding soluble glucose dehydrogenase) to reduce cytoplasmic glucose oxidation

    • Double deletion of both genes to redirect glucose metabolism entirely

  • Complementation studies: Reintroducing deleted genes on plasmids to confirm phenotypic changes are due to the specific gene deletion rather than polar effects or secondary mutations.

Biochemical and analytical methods:

  • Enzyme activity assays: Measuring the specific activities of key enzymes in cell extracts and membrane fractions:

    • Membrane-bound glucose dehydrogenase (mGDH) activity in membrane preparations

    • Soluble glucose dehydrogenase (sGDH) activity in cytoplasmic fractions

    • Gluconate kinase activity (reported to be ~0.5 U mg protein−1 in strain N44-1)

  • Metabolite analysis: Quantitative determination of:

    • Extracellular metabolites (gluconate, ketogluconates, acetate) by HPLC or enzymatic assays

    • CO2 production as an indicator of respiratory activity and complete oxidation

    • Intracellular metabolites to track cytoplasmic metabolism

  • Respiratory chain analysis: Measuring oxygen consumption rates and the activity of the respiratory chain to understand how electrons from periplasmic versus cytoplasmic oxidation enter the electron transport chain.

Growth and physiological characterization:

  • Growth parameter determination:

    • Measuring growth rates in various carbon sources

    • Determining biomass yields to quantify metabolic efficiency

    • Analyzing substrate consumption rates

  • Substrate specificity profiling: Testing growth and oxidation capabilities with various substrates (glucose, mannitol, glycerol, etc.) to identify the dependency on specific oxidation pathways .

Advanced techniques:

  • Isotope labeling: Using 13C-labeled substrates to track carbon flow through periplasmic versus cytoplasmic pathways.

  • Transcriptomic analysis: Employing RNA-seq to identify changes in gene expression patterns when periplasmic or cytoplasmic oxidation pathways are disrupted.

  • Proteomic analysis: Quantifying changes in protein abundance in response to metabolic rewiring, particularly focusing on enzymes involved in alternative pathways that become active when primary routes are blocked.

These experimental approaches, when combined, provide a comprehensive understanding of the unique dual oxidation system in G. oxydans and its implications for cellular energetics, growth, and biotechnological applications.

What methodologies are most effective for genetic manipulation of G. oxydans?

Genetic manipulation of G. oxydans requires specialized approaches due to its unique physiology and the relatively limited genetic tools available compared to model organisms. The following methodologies have proven effective for engineering G. oxydans strains:

Vector systems:

  • Shuttle vectors: Several plasmid systems have been successfully employed for gene expression in G. oxydans:

    • pBBR1MCS-5 derivatives: Used successfully for mGDH overexpression, with modified versions like pBBR-R3510-mGDH showing improved performance

    • pK19mobsacB: An effective suicide vector used for creating in-frame deletions

    • pSUP202: Used for gene disruption via insertion of antibiotic resistance cassettes

Gene deletion strategies:

  • In-frame deletion methodology:

    • Amplification of upstream and downstream regions of the target gene

    • Fusion of these regions by overlap extension PCR

    • Cloning into suicide vectors like pK19mobsacB

    • Two-step selection process: first for plasmid integration (positive selection), then for plasmid excision (negative selection using sucrose sensitivity)

  • Gene disruption via insertion:

    • Cloning a fragment of the target gene into a suicide vector

    • Inserting an antibiotic resistance cassette within this fragment

    • Selection for single-crossover integration events

Transformation methods:

  • Electroporation: The primary method for introducing plasmid DNA into G. oxydans, requiring optimization of:

    • Cell preparation protocol to enhance competence

    • Electroporation parameters (voltage, resistance, capacitance)

    • Recovery conditions post-electroporation

Selection markers:

  • Antibiotic resistance genes:

    • Kanamycin resistance: Used successfully in multiple studies for both gene deletion and expression

    • Other markers reported in literature but not mentioned in the provided search results

Verification techniques:

  • PCR-based verification:

    • Using primers that flank the target region to confirm desired genetic modifications

    • Example: Primers gdh-control-3 and gdh-control-5 used to verify mgdH deletion

  • Phenotypic verification:

    • Assessing changes in growth characteristics

    • Measuring enzymatic activities

    • Analyzing metabolite production profiles

Advanced genetic tools:

  • Transposon mutagenesis:

    • Tn5 transposon system has been successfully applied to G. oxydans

    • Valuable for identifying new genes involved in specific pathways, as demonstrated by the identification of the tldD gene's involvement in PQQ biosynthesis

These methodologies provide researchers with effective tools for manipulating G. oxydans for both fundamental research and biotechnological applications, though the toolbox continues to evolve as new approaches are developed and optimized for this industrially important organism.

How does the substrate specificity of mGDH impact its applications in biotransformation processes?

The substrate specificity of membrane-bound glucose dehydrogenase (mGDH) in G. oxydans extends beyond glucose to various other sugars and sugar alcohols, making it a versatile catalyst for diverse biotransformation processes. This broad specificity has significant implications for both fundamental research and industrial applications.

Substrate range of mGDH:
While the search results don't provide a comprehensive list of all substrates, they indicate that mGDH can oxidize:

  • D-glucose (the primary natural substrate)

  • D-xylose (enabling xylonic acid production)

Other membrane-bound dehydrogenases in G. oxydans that may share functional similarities with mGDH have been reported to oxidize:

  • D-sorbitol to L-sorbose (for vitamin C production)

  • N-formyl-1-amino-1-deoxy-d-sorbitol to N-formyl-6-amino-6-deoxy-l-sorbose (for miglitol precursor production)

  • Glycerol and various polyols

Methodological approaches to characterize substrate specificity:

  • Biochemical assays: Measuring oxidation rates with different substrates using purified enzyme or membrane preparations.

  • Growth phenotyping: Assessing the ability of wild-type versus mGDH-deficient strains to grow on various carbon sources .

  • Product analysis: Quantifying the formation of oxidized products from different substrates.

Applications leveraging mGDH substrate specificity:

  • D-xylonic acid production: The ability of mGDH to oxidize D-xylose has been exploited for the production of D-xylonic acid, a versatile platform chemical:

    • High titers (588.7 g/L) achieved through fed-batch biotransformation

    • Near-theoretical yields (99.4%)

    • High volumetric productivity (8.66 g/L/h)

  • Lignocellulosic biomass valorization: The ability to oxidize xylose allows direct conversion of lignocellulosic hydrolysates:

    • Production of 246.4 g/L D-xylonic acid from corn stover hydrolysate without detoxification

    • 98.9% yield

    • 11.2 g/L/h volumetric productivity

  • Potential for novel product development: The broad substrate specificity suggests opportunities for producing other oxidized sugar derivatives as platform chemicals or pharmaceutical precursors.

Enhancing mGDH activity through protein engineering:
While not specifically mentioned in the search results, the substrate specificity and catalytic properties of mGDH could potentially be further modified through protein engineering approaches such as:

  • Directed evolution to enhance activity toward specific substrates

  • Rational design based on structural insights

  • Fusion with additional domains to create bifunctional catalysts

The broad substrate range of mGDH, combined with its periplasmic localization (which simplifies product recovery), makes it an attractive biocatalyst for various oxidative biotransformations, particularly when overexpressed in recombinant G. oxydans strains optimized for specific applications.

What factors influence the expression and activity of quinoprotein glucose dehydrogenase in recombinant G. oxydans systems?

Multiple factors influence the expression and activity of quinoprotein glucose dehydrogenase in recombinant G. oxydans systems, affecting both the enzyme's production and its catalytic performance. Understanding and optimizing these factors is crucial for developing efficient biocatalysts for industrial applications.

Genetic factors affecting expression:

  • Promoter strength: The choice of promoter significantly impacts expression levels. While specific details are not provided in the search results, successful overexpression strategies likely involve strong, constitutive promoters or inducible systems optimized for G. oxydans.

  • Plasmid copy number: The use of different plasmid backbones (like pBBR1MCS-5 derivatives) affects gene dosage and consequently protein expression levels .

  • Codon optimization: Adapting the coding sequence to match the codon usage preferences of G. oxydans may enhance translation efficiency, though this isn't explicitly mentioned in the search results.

  • Gene integration site: For chromosomally integrated constructs, the genomic context can affect expression levels due to local chromatin structure and neighboring regulatory elements.

Factors affecting enzymatic activity:

  • PQQ availability: The activity of quinoprotein glucose dehydrogenase is directly dependent on the availability of its cofactor, PQQ. Strategies to enhance PQQ biosynthesis include:

    • Overexpression of the pqqA gene

    • Overexpression of the complete pqqABCDE cluster

    • Potentially optimizing the expression of auxiliary factors like the tldD gene product

  • Membrane incorporation: For mGDH, proper incorporation into the membrane is essential for activity. Factors that might affect this include:

    • Membrane composition

    • Presence of chaperones or assembly factors

    • Expression level (excessive overexpression might overwhelm membrane insertion machinery)

  • Post-translational modifications: While not explicitly discussed in the search results, any required post-translational modifications must occur correctly for full enzyme activity.

Environmental and cultivation factors:

  • pH conditions: G. oxydans naturally thrives at low pH values, which may affect both expression and activity of quinoprotein glucose dehydrogenase .

  • Oxygen availability: As an obligatory aerobic bacterium, oxygen supply is critical for G. oxydans metabolism and may impact both growth and enzymatic activity .

  • Substrate concentration: High substrate concentrations can affect both cell physiology and enzyme kinetics. The recombinant strain G. oxydans/pBBR-R3510-mGDH demonstrated improved tolerance to high substrate concentrations .

  • Inhibitor presence: When using lignocellulosic hydrolysates, inhibitors like formic acid, furfural, and 5-hydroxymethylfurfural can affect cellular metabolism and potentially enzyme activity. Interestingly, mGDH overexpression appears to enhance tolerance to these inhibitors .

Methodological approaches for optimization:

  • Strain engineering: Creating strains with improved growth characteristics by modifying central metabolism, such as inactivating competing pathways .

  • Process optimization: Developing fed-batch processes that maintain optimal conditions for enzyme expression and activity .

  • Medium composition: Optimizing nutrient availability to support both growth and enzyme production.

By systematically addressing these factors, researchers can develop recombinant G. oxydans strains with enhanced quinoprotein glucose dehydrogenase expression and activity, leading to improved performance in biotransformation processes.

How do the metabolic products of G. oxydans differ between wild-type and recombinant strains with modified glucose dehydrogenase activity?

The metabolic products of G. oxydans undergo significant changes when glucose dehydrogenase activity is modified through genetic engineering, reflecting fundamental shifts in carbon flux and energy metabolism. These differences have important implications for both basic research and biotechnological applications.

Wild-type G. oxydans metabolic profile:

  • Primary products from glucose:

    • Gluconate (intermediate)

    • 2-ketogluconate (end product)

    • 2,5-diketogluconate (end product)

  • Carbon dioxide production:

    • Relatively low CO2 formation due to incomplete oxidation in the periplasm

  • Biomass yield:

    • Low growth yield due to inefficient energy conservation from periplasmic oxidation

Metabolic profile of mGDH-deficient strains:

  • Altered glucose metabolism:

    • No production of gluconate or ketogluconates

    • Complete uptake and metabolism of glucose through cytoplasmic pathways

  • Increased respiratory activity:

    • CO2 formation increased by a factor of 4 (single mutant) or 5.5 (double mutant)

    • Indicates more complete oxidation via the pentose phosphate pathway and Entner-Doudoroff pathway

  • Novel product formation:

    • Significant acetate accumulation, likely through pyruvate decarboxylase and acetaldehyde dehydrogenase activities

    • This pathway is inactive in wild-type cells but becomes active in mutants, possibly due to acetyl-CoA accumulation and allosteric inhibition of pyruvate dehydrogenase

  • Improved growth parameters:

    • Growth yield increased by 110% (mGDH single mutant) to 271% (mGDH/sGDH double mutant)

    • Growth rate improved by 39% (single mutant) to 78% (double mutant)

Metabolic profile of mGDH-overexpressing strains:

  • Enhanced oxidative capacity:

    • Improved ability to oxidize substrates like D-xylose to D-xylonic acid

    • Higher production rates and yields compared to wild-type strains

  • Tolerance to inhibitors:

    • Increased resistance to lignocellulosic hydrolysate inhibitors (formic acid, furfural, 5-hydroxymethylfurfural)

    • Enables direct conversion of non-detoxified biomass hydrolysates

Methodological approaches to characterize metabolic differences:

  • Quantitative metabolite analysis:

    • HPLC or enzymatic assays to measure primary products

    • CO2 evolution measurement to assess respiratory activity

  • Growth parameter determination:

    • Measurement of biomass formation

    • Calculation of growth rates and yields

  • Substrate consumption analysis:

    • Monitoring the depletion of carbon sources over time

  • Product formation kinetics:

    • Tracking the formation of products during batch or fed-batch cultivation

    • Determining volumetric productivity and maximum titers

These metabolic shifts highlight the plasticity of G. oxydans metabolism and demonstrate how targeted genetic modifications can dramatically alter the organism's metabolic profile to enhance either growth efficiency or production capabilities, depending on the desired application.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.