Recombinant Glutamate transport system permease protein gluC (gluC)

Shipped with Ice Packs
In Stock

Description

Functional Role in Glutamate Uptake

  • Km Modulation: In C. glutamicum, GluC contributes to a high-affinity glutamate uptake system (Km = 1.5 μM). Treatment with globomycin, which inhibits lipoprotein processing, increases Km to 1,400 μM, indicating GluC’s dependence on functional interactions with the periplasmic binding protein GluB .

  • Gene Deletion Studies: Strains lacking gluC show a 14-fold reduction in glutamate uptake (from 1.4 to <0.1 nmol/min/mg), confirming its essential role .

Recombinant Production and Applications

Recombinant GluC is synthesized for structural and functional studies. Key parameters include:

ParameterDetail
Expression RegionFull-length protein (1–225 aa) .
StorageStable at -20°C in Tris-based buffer with 50% glycerol .
ApplicationsUsed in proteoliposome assays to study transport kinetics and inhibitor responses .

Comparative Analysis with Related Transporters

While GluC is specific to Corynebacterium, homologs like E. coli GltJ share functional similarities but differ genetically. For example:

  • E. coli GltJ (part of the GltJKLM system) requires the regulator GltR for expression, whereas GluC is regulated by the gluABCD operon .

  • Unlike eukaryotic glutamate transporters (e.g., EAATs), GluC operates without chloride channel activity .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, serving as a reference for your convenience.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development according to your specifications.
Synonyms
gluC; CE1846; Glutamate transport system permease protein GluC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Target Names
gluC
Target Protein Sequence
MSTLWADLGPSLLPAFWVTIQLTVYSAIGSMILGTILTAMRVSPVKILRSISTAYINTVR NTPLTLVILFCSFGLYQNLGLTLAGRDSSTFLADNNFRLAVLGFILYTSAFVAESLRSGI NTVHFGQAEAARSLGLGFSDIFRSIIFPQAVRAAIIPLGNTLIALTKNTTIASVIGVGEA SLLMKSTIENHANMLFVVFAIFAVGFMILTLPMGLGLGKLAEKMAVKK
Uniprot No.

Target Background

Function
This protein is part of the binding-protein-dependent transport system for glutamate. It is likely responsible for the translocation of the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, HisMQ subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of the gluABCD cluster and where does gluC fit within this system?

The gluABCD cluster is a four-gene operon encoding components of a binding protein-dependent glutamate uptake system (ABC transporter). Sequencing of 3,977 bp revealed that within this cluster, gluC encodes an integral membrane protein that functions as part of the transmembrane domain of the transporter. The gene cluster includes components with characteristic polypeptide sequences: GluA (a nucleotide-binding protein), GluB (a periplasmic binding protein), and GluC and GluD (integral membrane proteins). The entire system contains prominent intergenic regions ranging from 120 to 138 bp, which is notably larger than those typically found in other gram-positive species, where intergenic regions are often less than 20 nucleotides .

What expression systems have been successfully used for recombinant GluC production?

While the search results do not specifically detail GluC expression systems, related membrane transporters such as human xCT have been successfully expressed in E. coli under carefully controlled conditions. For optimal expression of these hydrophobic membrane proteins, key factors include using low IPTG concentrations (0.05 mM), maintaining glucose in the growth medium (0.5%), and controlling induction time (with 8 hours showing better yields than 6 hours in some cases). The catabolite repression phenomenon appears crucial for obtaining protein expression of these transporters, suggesting similar approaches might be applicable to GluC .

How can site-directed mutagenesis be applied to investigate the functional domains of GluC?

Site-directed mutagenesis of GluC should target the five predicted membrane-spanning segments to identify residues critical for substrate specificity, translocation, and interaction with other components of the transport system. Research approaches could include:

  • Systematic alanine scanning of transmembrane domains to identify essential residues

  • Mutation of conserved residues identified through sequence alignment with related transporters like OppB, OppC, MalG, HisQ, and HisM

  • Introduction of reporter groups at specific positions to probe conformational changes during transport

  • Creation of chimeric proteins with other membrane transporters to investigate domain function

Following mutagenesis, functional assessment should include reconstitution in proteoliposomes to determine changes in transport kinetics, substrate specificity, and interaction with other components of the transporter complex .

What are the optimal conditions for reconstituting purified GluC into proteoliposomes for functional studies?

While specific protocols for GluC reconstitution are not detailed in the search results, lessons from related membrane transporters suggest several critical parameters:

  • Lipid composition: Mixtures of phosphatidylcholine, phosphatidylethanolamine, and cholesterol at ratios mimicking bacterial membranes

  • Protein-to-lipid ratio: Typically 1:50 to 1:100 (w/w) for optimal activity

  • Reconstitution method: Detergent-mediated incorporation followed by controlled detergent removal via dialysis or Bio-Beads

  • Buffer conditions: pH 7.0-7.4 with physiologically relevant salt concentrations

  • Temperature: Reconstitution at 4°C to preserve protein integrity

The reconstituted proteoliposomes should be validated for protein orientation, transport activity, and substrate specificity using radioisotope flux assays or fluorescence-based methods .

How can structural information from related transporters inform our understanding of GluC function?

Recent structural studies of the xCT/CD98 heterodimer by Cryo-EM have provided valuable insights into glutamate transporter mechanisms, revealing conformational states in apo, glutamate-bound, and inhibitor-bound forms. These structures can inform homology modeling of GluC to predict:

  • Substrate binding sites and key interaction residues

  • Conformational changes during the transport cycle

  • Interfaces with other components of the transport complex (GluA and GluD)

  • Potential allosteric regulatory sites

Researchers should perform sequence alignment between GluC and structurally characterized transporters, followed by computational modeling to generate testable hypotheses about structure-function relationships. Experimental validation could then proceed through site-directed mutagenesis of predicted functional residues .

What strategies can optimize recombinant GluC expression in E. coli?

Based on successful expression of similar membrane transporters, researchers should consider:

ParameterOptimal ConditionRationale
IPTG concentration0.05 mMHigher concentrations may increase toxicity
Glucose0.5%Enables catabolite repression phenomenon
Induction time8 hoursAllows slower, less toxic protein accumulation
Growth temperature20-25°CReduces inclusion body formation
E. coli strainC41(DE3) or C43(DE3)Engineered for membrane protein expression
VectorpET with T7 promoterControllable expression

The expression optimization should be monitored by Western blot analysis, as membrane proteins often show anomalous migration on SDS-PAGE (appearing at lower molecular weights than predicted). For GluC, which has a theoretical molecular mass of approximately 57 kDa, the observed band might appear at around 45 kDa, similar to other hydrophobic membrane transporters .

What are the most effective purification strategies for membrane-integrated GluC?

Purification of integral membrane proteins like GluC requires specialized approaches:

  • Membrane isolation: Differential centrifugation followed by separation on sucrose gradients

  • Solubilization: Screening multiple detergents (DDM, LDAO, FC-12) at various concentrations

  • Affinity chromatography: Using engineered His-tags or other affinity tags

  • Size exclusion chromatography: For final polishing and detergent exchange

  • Stability assessment: Thermal shift assays to identify stabilizing buffer conditions

Researchers should monitor protein purity by SDS-PAGE and Western blotting, and confirm functionality through binding assays or limited reconstitution experiments throughout the purification process .

How can researchers distinguish between GluC-mediated transport and other glutamate transport systems in experimental systems?

Researchers face challenges in isolating GluC-specific activity due to the presence of multiple transport systems with overlapping substrate specificity. Several approaches can address this:

  • Gene deletion studies: Construction of strains with the entire gluABCD cluster deleted (as demonstrated in C. glutamicum, which reduced glutamate uptake from 1.4 to less than 0.1 nmol/min/mg)

  • Reconstituted systems: Using purified components in proteoliposomes to study GluC in isolation

  • Inhibitor profiles: Identifying specific inhibitors that differentially affect GluC versus other transporters

  • Substrate specificity analysis: Comparing transport kinetics with various substrates and analogues

  • Side-specific assays: Developing assays that can measure directional transport in reconstituted systems

These approaches allow for accurate determination of intrinsic kinetic parameters and mechanistic details without interference from other molecular systems .

What spectroscopic methods are most suitable for probing conformational changes in GluC during the transport cycle?

Several biophysical techniques can provide insights into GluC conformational dynamics:

  • Site-directed spin labeling (SDSL) combined with electron paramagnetic resonance (EPR) spectroscopy

  • Fluorescence resonance energy transfer (FRET) using strategically placed fluorophores

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

  • Single-molecule FRET for studying conformational distributions

  • Tryptophan fluorescence spectroscopy for probing local environmental changes

These techniques require the introduction of reporter groups at specific positions through mutagenesis, followed by reconstitution in a membrane-like environment. Measurements in the presence and absence of substrates, nucleotides, and other components of the transport system can reveal the sequence and nature of conformational changes during the transport cycle .

How can cryo-electron microscopy be optimized for structural determination of the entire GluABCD complex?

Based on successful approaches with related transporters such as xCT/CD98:

  • Sample preparation:

    • Detergent screening (DDM, GDN, LMNG) to identify optimal solubilization conditions

    • Addition of lipids (especially CHS) to stabilize the complex

    • Incorporation of substrate analogs or transport inhibitors to trap specific conformational states

  • Grid preparation:

    • Optimization of protein concentration (typically 2-5 mg/ml)

    • Testing multiple grid types (Quantifoil, C-flat) and hole sizes

    • Exploring additives to improve particle distribution (detergents, salts)

  • Data collection:

    • High-end microscopes (Titan Krios, Glacios) with energy filters

    • Movie-mode acquisition with dose fractionation

    • Collection of large datasets (>5000 micrographs) for adequate sampling

  • Image processing:

    • Careful CTF estimation and correction

    • 2D and 3D classification to sort heterogeneous populations

    • Focused refinement of dynamic domains

Recent successes with related transporters suggest that resolutions of 3-4 Å are achievable, allowing visualization of transmembrane helices and potentially substrate binding sites .

What kinetic parameters should be measured to fully characterize GluC-mediated transport, and how do they compare with the intact GluABCD system?

A comprehensive kinetic characterization should include:

ParameterMeasurement ApproachSignificance
Km (substrate affinity)Concentration-dependent uptakeReflects binding step efficiency
Vmax (maximum velocity)Saturation kineticsReflects translocation step capacity
kcat (turnover number)Enzyme kineticsTransport cycles per unit time
Substrate specificityCompetition assaysTransporter selectivity
Coupling ratioSimultaneous flux measurementsStoichiometry of exchange
Temperature dependenceArrhenius plotsActivation energy barriers
pH dependenceActivity across pH rangeProton coupling mechanism

For the intact GluABCD system in C. glutamicum, the Km for glutamate is approximately 1.5 μM, representing high-affinity transport. When the binding protein function is impaired (as in globomycin treatment), the Km increases dramatically to 1,400 μM while Vmax remains relatively unchanged. This indicates that the membrane components (GluC and GluD) primarily determine the maximum transport capacity, while the binding protein (GluB) is critical for high-affinity substrate recognition .

How does the energy coupling mechanism of GluC differ from other bacterial nutrient transporters?

As part of an ABC transporter system, GluC likely participates in a transport mechanism where:

  • The nucleotide-binding domain (GluA) hydrolyzes ATP to drive conformational changes

  • These conformational changes are transmitted to the transmembrane domains (GluC and GluD)

  • The transmembrane domains alternate between inward-facing and outward-facing conformations

  • The periplasmic binding protein (GluB) delivers substrate to the outward-facing conformation

This differs from:

  • Secondary active transporters that use ion gradients (Na⁺, H⁺) for energy coupling

  • Group translocation systems that chemically modify substrates during transport

  • Facilitated diffusion carriers that transport along concentration gradients

Experimental approaches to investigate this would include measuring ATP hydrolysis rates in parallel with transport rates, using ATP analogs, and assessing the effects of ionophores that dissipate membrane potential or ion gradients .

What regulatory mechanisms control gluC expression and how might they be experimentally manipulated?

The gluABCD cluster in C. glutamicum demonstrates regulated expression, with glutamate inducing higher expression compared to glucose. Control elements likely include:

  • Promoter region upstream of gluA

  • Stem-loop structures between genes (particularly between gluB and gluC)

  • Rho-independent terminator following gluD

Experimental approaches to investigate and manipulate regulation include:

  • Reporter gene fusions (lacZ, gfp) to monitor promoter activity

  • Electrophoretic mobility shift assays (EMSA) to identify regulatory proteins

  • Deletion analysis of potential regulatory elements

  • RNA stability assays to assess the role of stem-loop structures

  • Creation of constitutive expression strains by promoter replacement

  • Response element mutation to create regulation-resistant variants

Evidence suggests that growth on glutamate versus glucose affects transport rates (Table 1 in ), indicating substrate-responsive regulation. The presence of regulatory structures on the sequenced fragment suggests that all elements needed for expression and control reside within this region .

How conserved is GluC across different bacterial species, and what functional implications do sequence variations have?

While the search results don't provide comprehensive information on GluC conservation, several approaches can address this question:

  • Phylogenetic analysis of GluC homologs across bacterial phyla

  • Identification of conserved motifs within transmembrane domains

  • Correlation of sequence variations with substrate specificity differences

  • Functional complementation studies across species

Researchers should perform multiple sequence alignments of GluC with homologs from diverse species, identifying both highly conserved residues (likely critical for core functions) and variable regions (potentially related to species-specific adaptations). Functional implications can be tested through heterologous expression and chimeric protein construction .

How do structural and functional characteristics of GluC compare with other membrane components of ABC transporters?

GluC shares structural similarities with other bacterial ABC transporter membrane components. Key comparisons include:

  • Membrane topology: GluC's five predicted membrane-spanning segments differ from the six segments found in OppB, OppC, and MalG, but match the five segments in HisQ and HisM

  • Oligomeric state: GluC likely forms a heterodimer with GluD, similar to other ABC transport systems

  • Substrate specificity determinants: Comparison with other transporters can help identify specificity-determining regions

Experimental approaches could include construction of chimeric proteins between GluC and other well-characterized transporters (such as MalG or OppC) to identify domains responsible for specific functions like substrate recognition, nucleotide-binding domain interaction, or conformational coupling .

What biotechnological applications might benefit from engineered GluC variants with modified transport properties?

Engineered GluC variants could contribute to several biotechnological applications:

  • Enhanced amino acid production in industrial strains of Corynebacterium glutamicum

  • Development of biosensors for glutamate detection in biological samples

  • Creation of strains with improved nutrient utilization for bioremediation

  • Design of cellular factories with controlled glutamate uptake for metabolic engineering

Strategic modifications might include:

  • Altering substrate specificity to transport non-natural amino acids

  • Enhancing transport rates through directed evolution

  • Creating regulatable variants for controlled uptake

  • Designing inhibitor-resistant mutants for selective growth advantages

These applications would require detailed understanding of structure-function relationships and precise engineering of the transporter at the molecular level .

What are the most significant technical challenges in reconstituting functional GluC for biophysical studies, and how might they be overcome?

Reconstitution of GluC presents several technical challenges:

  • Maintaining native conformation during solubilization and purification

    • Solution: Screen multiple detergents and stabilizing additives

  • Achieving correct orientation in proteoliposomes

    • Solution: Develop asymmetric reconstitution protocols or orientation-specific assays

  • Assessing functional integrity

    • Solution: Develop sensitive transport assays using radiolabeled substrates or fluorescent indicators

  • Co-reconstitution with partner proteins (GluA, GluB, GluD)

    • Solution: Purify individual components and reconstitute in controlled ratios

  • Low yield of functional protein

    • Solution: Optimize expression conditions and develop scaled-up purification protocols

Advances in lipid nanodisc technology also offer promising alternatives to traditional proteoliposomes, potentially providing a more stable and defined environment for functional and structural studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.