Recombinant Glutamate/aspartate transport system permease protein gltJ (gltJ)

Shipped with Ice Packs
In Stock

Description

  • N-terminal Cytoplasmic Region (1–222 residues):

    • Zinc-finger (ZnR) domain (1–42 residues): Binds MglB to regulate GTP hydrolysis .

    • Glycine-Tyrosine-Phenylalanine (GYF) domain (138–222 residues): Interacts with AglZ’s proline-rich sequence (PRS) to recruit components of the bacterial focal adhesion (bFA) complex .

    • Linker region (43–137 residues): Binds MglA-GTP, triggering conformational changes that expose the ZnR domain .

  • Transmembrane Helix (385–405 residues): Anchors the protein in the inner membrane .

  • Periplasmic TonB-C Domain (584–674 residues): Mediates energy transduction via TonB-dependent processes .

Nutrient Transport

gltJ is an essential permease in the glutamate/aspartate ABC transporter, working alongside GltI (ATPase), GltK (lipoprotein), and GltL (substrate-binding protein) to import these amino acids . The TonB-C domain facilitates substrate binding and energy coupling .

Bacterial Motility

gltJ is a core component of the Agl-Glt gliding motility machinery, bridging the cytoplasmic MreB cytoskeleton to the periplasmic motility complex:

  • Recruitment of AglZ: The GYF domain binds AglZ’s PRS, stabilizing bFAs at the leading cell pole .

  • MglA-GTP Binding: The linker region binds MglA-GTP, inducing a conformational switch that releases the ZnR domain .

  • MglB Recruitment: The exposed ZnR domain recruits MglB, a GTPase-activating protein (GAP), which hydrolyzes MglA-GTP at the lagging pole, disassembling bFAs .

Molecular Switch Mechanism

gltJ regulates bFA assembly/disassembly via a MglA-GTP-dependent conformational switch:

  1. MglA-GTP Binding: Binds the linker region, disrupting ZnR-linker interactions and exposing the ZnR domain .

  2. MglB Recruitment: ZnR binds MglB’s C-terminal helix, enhancing MglA GTP hydrolysis .

  3. bFA Disassembly: Hydrolysis of MglA-GTP releases AglZ and MreB, halting motility at the lagging pole .

Key InteractionsInteraction PartnersFunctional Impact
GYF domainAglZ PRSRecruitment to bFAs
Linker regionMglA-GTPConformational switch
ZnR domainMglBGTPase activation

Research Applications

Recombinant gltJ is used in:

  • Transport Studies: Investigating glutamate/aspartate uptake kinetics and ABC transporter assembly .

  • Motility Research: Probing bFA dynamics, MglA/MglB regulation, and cytoskeleton interactions .

  • Structural Biology: NMR and cryo-EM studies to resolve domain interactions and conformational changes .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
gltJ; c0738; Glutamate/aspartate import permease protein GltJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-246
Protein Length
full length protein
Species
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Target Names
gltJ
Target Protein Sequence
MSIDWNWGIFLQQAPFGNTTYLGWIWSGFQVTIALSICAWIIAFLVGSFFGILRTVPNRF LSGLGTLYVELFRNVPLIVQFFTWYLVIPELLPEKIGMWFKAELDPNIQFFLSSMLCLGL FTAARVCEQVRAAIQSLPRGQKNAALAMGLTLPQAYRYVLLPNAYRVIVPPMTSEMMNLV KNSAIASTIGLVDMAAQAGKLLDYSAHAWESFTAITLAYVLINAFIMLVMTLVERKVRLP GNMGGK
Uniprot No.

Target Background

Function
This protein, gltJ, is part of the ABC transporter complex GltIJKL, which is involved in the uptake of glutamate and aspartate. It is likely responsible for translocating the substrate across the membrane.
Database Links

KEGG: ecc:c0738

STRING: 199310.c0738

Protein Families
Binding-protein-dependent transport system permease family, HisMQ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of GltJ protein?

GltJ (also known as AgmX) is a bacterial transmembrane protein that plays a crucial role in the assembly and function of bacterial focal adhesions (bFAs). Structurally, GltJ contains a cytosolic N-terminal region connected to a single transmembrane helix, which is followed by a flexible poorly structured region and a TonB-C domain in the periplasm . The cytosolic N-terminal region (Nt1-222) has been identified as particularly important for GltJ function and contains multiple domains including a GYF domain and a zinc ribbon (ZnR) domain connected by a linker region . Functionally, GltJ serves as a molecular switch that controls the spatial assembly of bacterial focal adhesion complexes by sensing the MglA-GTP gradient within the cell . This sensing mechanism allows for the proper localization and assembly of the motility machinery, which is essential for bacterial gliding motility and normal cellular function . Mutations or deletions in GltJ result in significant motility defects, highlighting its importance in bacterial movement systems .

How does GltJ interact with other proteins in the bacterial focal adhesion complex?

The interaction network of GltJ within bacterial focal adhesion complexes is primarily centered around its direct binding with platform proteins MglA and AglZ . These interactions occur through specific domains within the N-terminal region (Nt1-222) of GltJ. The GYF domain of GltJ interacts with the proline-rich sequence (PRS) of AglZ with micromolar affinity, as demonstrated through isothermal titration calorimetry (ITC) experiments . This interaction involves residues from the GYF β sheet, creating an interaction surface distinctly different from canonical GYF domains . Additionally, the linker region between the GYF and ZnR domains interacts directly with MglA-GTP, serving as a sensor for the MglA-GTP gradient within the cell . Nuclear magnetic resonance (NMR) spectroscopy has confirmed that while individual GYF and ZnR domains do not interact with MglA-GTP, the linker region shows chemical shift perturbations in the presence of MglA-GTP, indicating direct binding . These molecular interactions form the basis for GltJ's role as a switch that controls the assembly and disassembly of bacterial focal adhesions based on spatial cues within the cell .

What experimental approaches are commonly used to study GltJ expression and localization?

Researchers studying GltJ expression and localization typically employ a combination of genetic engineering, fluorescence microscopy, and biochemical techniques to gain comprehensive insights. Fluorescent protein tagging, particularly using NeonGreen (NG) fusions at the N-terminus of GltJ, has proven effective for visualizing the protein's localization in living bacterial cells . These constructs allow researchers to track the dynamic assembly and disassembly of GltJ-containing focal adhesions through time-lapse microscopy and kymograph representations . To verify protein expression levels, Western blotting using antibodies against specific regions of GltJ (such as the N-terminal region) is commonly employed . Deletion mutants (such as ΔgltJ) and domain-specific mutants (like GltJ ΔNt1-222) are created to assess the functional importance of different protein regions, with their expression verified using the same techniques . For quantitative analysis of GltJ dynamics, researchers often measure motility speeds and mean square displacement (MSD) in various mutant strains compared to wild-type bacteria . Advanced imaging techniques such as fluorescence recovery after photobleaching (FRAP) or single-molecule tracking may also be used to measure the turnover and mobility of GltJ within the focal adhesion complexes.

What phenotypes are observed in gltJ mutant or knockout strains?

Bacterial strains with gltJ mutations or complete gene deletions exhibit several distinctive phenotypes that highlight the crucial role of this protein in cellular function. The most prominent phenotype is a complete defect in bacterial focal adhesion (bFA)-dependent motility, rendering cells unable to move using their gliding motility system . This motility defect is observable through various experimental approaches, including direct tracking of cell movement and analysis of colony spreading on soft agar plates . At the subcellular level, deletion of gltJ leads to the complete loss of bFA formation, indicating that GltJ is essential for the proper assembly of these adhesion complexes . Even partial modifications to GltJ structure can cause significant phenotypic changes; for example, strains expressing GltJ lacking the N-terminal region (GltJ ΔNt1-222) show defects comparable to complete gltJ deletion . More subtle mutations, such as deletion of just the GYF domain (gyf strain), result in reduced motility speeds and mean square displacement (MSD) compared to wild-type cells, but not complete motility abolishment . Additionally, fluorescence microscopy reveals that in strains where AglZ-NG (a component of the motility complex) is introduced into a gltJ deletion background, focal adhesion formation is completely abolished, demonstrating the dependency of other focal adhesion components on GltJ .

How does the molecular structure of GltJ domains contribute to its function as a molecular switch?

The molecular architecture of GltJ reveals a sophisticated design that enables its function as a biological switch controlling bacterial focal adhesion assembly. Nuclear magnetic resonance (NMR) spectroscopy has resolved the three-dimensional structure of the GYF domain (GYF GltJ), showing a canonical fold consisting of a four-stranded β sheet and two α helices, despite lacking the characteristic G, Y, and F residues typically found in eukaryotic GYF domains . This structural conservation allows GYF GltJ to function as a protein-protein interaction module that specifically recognizes the proline-rich sequence (PRS) of AglZ . The interaction surface involves residues from the GYF β sheet, which is distinctly different from canonical GYF domains, suggesting evolutionary adaptation for bacterial systems . Adjacent to the GYF domain, the linker region exists in a disordered state, demonstrated by NMR spectra showing narrow amide 1H chemical shift dispersion typical of unstructured protein segments . This intrinsic disorder is functionally significant as it enables the linker to act as a flexible sensor that can interact with MglA-GTP, thereby connecting the cytoskeletal elements to the motility machinery . The zinc ribbon domain (ZnR GltJ) adds another layer of structural complexity, though its specific interactions remain less characterized . Together, these domains create a sophisticated molecular sensor that integrates spatial information about the MglA-GTP gradient within the cell and translates it into mechanical control of focal adhesion assembly, exemplifying how molecular architecture can encode switch-like behaviors in biological systems .

What experimental approaches can resolve contradictory data regarding GltJ interactions with binding partners?

When faced with contradictory data regarding GltJ interactions, researchers should implement a multi-method validation strategy combining both in vitro and in vivo approaches. Isothermal titration calorimetry (ITC) experiments provide quantitative binding parameters, including affinity constants and thermodynamic values, and should be performed using both full-length proteins and isolated domains to resolve domain-specific contributions to binding . These results should be complemented with nuclear magnetic resonance (NMR) spectroscopy to map interaction surfaces at atomic resolution through chemical shift perturbation (CSP) analysis, which can definitively identify which residues are involved in protein-protein interfaces . For contradictory localization data, researchers should employ dual-color fluorescence microscopy with orthogonal tags (such as combining NeonGreen and mCherry fusions) to simultaneously track multiple proteins in living cells, allowing direct visualization of co-localization or sequential recruitment . Pull-down assays with systematic truncation or point mutation series can help delineate exact interaction boundaries and essential residues, while in vivo crosslinking coupled with mass spectrometry (XL-MS) can capture transient interactions that might be missed by other techniques . To address whether interactions are direct or mediated by additional factors, bacterial two-hybrid assays and in vitro reconstitution experiments with purified components are essential . Finally, implementing CRISPR-interference or inducible depletion systems can help determine whether contradictory observations arise from secondary effects of complete protein removal versus partial function retention in different experimental systems .

How can researchers design optimal pilot experiments for studying GltJ function in different bacterial species?

Designing optimal pilot experiments for cross-species GltJ functional studies requires a systematic approach that maximizes information gain while minimizing resource expenditure. Initially, researchers should conduct comprehensive bioinformatic analyses to identify GltJ homologs across target bacterial species, generating multiple sequence alignments to highlight conserved domains and species-specific variations . This comparative analysis should inform the construction of a phylogenetic tree to select representative species that span evolutionary distances . For experimental design, researchers should implement a low-discrepancy sampling approach rather than completely randomized sampling, as this has been shown to provide more efficient coverage of the parameter space in pilot experiments with limited prior information . The experimental design should incorporate both conserved positive controls (such as testing interactions with highly conserved binding partners) and species-specific tests based on predicted functional divergence . To address the challenge of unknown parameter values in generalized linear models (GLMs) that might be used to analyze results, researchers should adopt a Bayesian experimental design framework that accounts for parameter uncertainty . This approach allows for sequential updating of the experimental design as preliminary data becomes available . When conducting cross-species complementation experiments, careful attention must be paid to codon optimization and expression levels, as these factors can significantly impact apparent functionality . Finally, researchers should implement a factorial design approach that systematically tests combinations of domains from different species to identify which protein regions are responsible for species-specific functions versus universally conserved mechanisms .

How should researchers interpret contradictory localization patterns of GltJ in different experimental conditions?

When confronted with contradictory localization patterns of GltJ across different experimental conditions, researchers must systematically evaluate multiple biological and technical factors that might explain these discrepancies. The dynamic nature of GltJ as a molecular switch means that its localization is inherently condition-dependent, with studies showing that it can range from polar localization to forming discrete clusters along the cell body to appearing diffuse throughout the membrane . Researchers should first examine the temporal dimension, as time-lapse microscopy and kymograph representations have revealed that GltJ undergoes dynamic redistribution during the bacterial cell cycle and motility events . The method of protein labeling is critical; N-terminal NeonGreen (NG) fusions have been shown to be largely functional with only slight reductions in motility speeds, whereas other tagging approaches might more severely impact protein function and localization . The expression level of tagged GltJ constructs must be carefully controlled, as overexpression can lead to artifacts such as protein aggregation or overwhelming of normal localization mechanisms . Genetic background significantly impacts GltJ localization; for example, in strains lacking key interaction partners such as AglZ or MglA, GltJ shows altered localization patterns . Environmental conditions including nutrient availability, surface properties, and cell density have been shown to affect the assembly and distribution of bacterial focal adhesions containing GltJ . Technical imaging parameters including microscope resolution, exposure times, and image processing algorithms can dramatically affect the apparent localization patterns, requiring standardized imaging protocols and appropriate controls . Finally, researchers should implement correlative approaches that combine complementary techniques such as fluorescence microscopy with electron microscopy or super-resolution methods to distinguish genuine biological variations from technical artifacts .

What statistical approaches are most appropriate for analyzing GltJ recruitment dynamics to focal adhesions?

The analysis of GltJ recruitment dynamics to focal adhesions requires sophisticated statistical approaches that can capture the spatiotemporal complexity of this biological process. Time series analysis using hidden Markov models (HMMs) provides a powerful framework for identifying distinct states in GltJ localization patterns and quantifying transition probabilities between these states . For analyzing the spatial distribution of GltJ clusters, point process statistics such as Ripley's K-function or pair correlation functions can quantify whether the distribution of focal adhesions follows random, clustered, or regular patterns . When examining the relationship between GltJ recruitment and cellular outcomes such as motility speed, researchers should implement generalized linear models (GLMs) with appropriate link functions that account for the non-normal distribution of biological data . The design of such statistical models requires careful consideration of parameter uncertainty, particularly in pilot experiments where prior information is limited . For this reason, Bayesian statistical approaches that can incorporate prior knowledge and update uncertainties as new data becomes available are particularly valuable . When comparing recruitment dynamics across different strains or conditions, mixed-effects models that account for both fixed effects (experimental conditions) and random effects (cell-to-cell variability) provide more accurate inference than simple comparison of means . For high-dimensional data generated by techniques such as single-particle tracking or live-cell imaging, dimensionality reduction methods like principal component analysis (PCA) or t-distributed stochastic neighbor embedding (t-SNE) can help identify patterns in GltJ dynamics that might not be apparent from simple measurements . Finally, researchers should implement cross-validation procedures to ensure that statistical models are not overfitting to the specific dataset but rather capturing generalizable principles of GltJ dynamics .

How can researchers distinguish between direct and indirect effects when studying GltJ mutant phenotypes?

Distinguishing between direct and indirect effects in GltJ mutant phenotypes requires a multi-faceted experimental approach that systematically isolates causal relationships from correlative observations. Domain-specific mutations provide a powerful starting point, as demonstrated by studies comparing the phenotypes of complete gltJ deletion versus targeted mutations in specific domains such as the GYF domain or N-terminal region deletion (ΔNt1-222) . These comparative analyses revealed that while complete deletion abolishes focal adhesion formation entirely, more specific mutations can produce intermediate phenotypes that help delineate domain-specific functions . Complementation experiments using wild-type or mutant alleles expressed in trans can determine whether phenotypes are directly caused by the mutation or arise from polar effects on neighboring genes . For protein-protein interactions, researchers should implement both in vivo approaches such as bacterial two-hybrid systems and in vitro reconstitution with purified components to distinguish direct binding from interactions mediated by additional factors . Time-resolved experiments are crucial for establishing causality, as they can determine the sequence of events following perturbation of GltJ function . For example, time-lapse microscopy of AglZ-NG in various GltJ mutant backgrounds revealed that GltJ is required for initial recruitment of AglZ to focal adhesions, establishing a direct dependency relationship . Genetic epistasis analysis, where double mutants are created and phenotyped, can reveal whether genes function in the same or parallel pathways . Quantitative phenotyping that measures multiple parameters (such as focal adhesion formation, stability, and motility speeds) can help create detailed phenotypic signatures that are more informative than binary assessments . Finally, systems-level approaches such as transcriptomics or proteomics comparing wild-type and mutant strains can identify compensatory responses that might mask or exacerbate primary defects, helping to separate direct consequences of GltJ mutation from downstream adaptive responses .

What are the optimal conditions for expressing and purifying recombinant GltJ for functional studies?

The optimization of recombinant GltJ expression and purification requires careful consideration of multiple parameters to ensure both high yield and proper protein folding. For bacterial expression systems, BL21(DE3) strains containing the pLysS plasmid have shown success for expressing individual domains such as the GYF domain, while more specialized strains like C41(DE3) or C43(DE3) designed for membrane protein expression may be required for full-length GltJ . Expression temperature significantly impacts protein folding, with lower temperatures (16-18°C) generally favoring proper folding over high yield, especially for the transmembrane domain-containing full-length protein . For the N-terminal region (Nt1-222), a His-tag fusion expressed in E. coli with induction at OD600 of 0.6-0.8 using 0.5mM IPTG for 4 hours at 30°C has been demonstrated to yield functional protein amenable to structural studies . Lysis buffer composition is critical, with the inclusion of protease inhibitors, reducing agents, and appropriate detergents (for full-length protein) being essential; for the zinc ribbon domain, the addition of zinc chloride (10-50μM) helps maintain proper metal coordination . Purification of GltJ domains has been successfully achieved using nickel affinity chromatography followed by size exclusion chromatography, with buffer conditions (typically 20mM Tris-HCl pH 7.5, 150mM NaCl, 5mM β-mercaptoethanol) optimized to maintain protein stability . For structural studies by NMR, isotopic labeling with 15N and 13C has been successfully implemented for the GYF domain, requiring growth in minimal media with 15NH4Cl and 13C-glucose as sole nitrogen and carbon sources . Storage conditions also significantly impact protein stability, with flash-freezing in small aliquots containing 10% glycerol and storage at -80°C showing good retention of activity for the N-terminal domains .

What experimental design principles should researchers follow when studying the GltJ interaction network?

A comprehensive experimental design for studying the GltJ interaction network should follow a systematic approach that combines complementary techniques with appropriate controls. Initial mapping of potential interaction partners should utilize unbiased approaches such as proximity-based labeling (BioID or APEX) or co-immunoprecipitation followed by mass spectrometry to identify the full complement of proteins associated with GltJ in vivo . Based on these initial surveys, researchers should implement a staged validation strategy, beginning with binary interaction tests using techniques such as bacterial two-hybrid or pulldown assays with purified proteins to confirm direct interactions . For each putative interaction, domain mapping experiments using truncation series or point mutations should be performed to identify the specific regions involved, as demonstrated with the characterization of the GYF domain interaction with the PRS domain of AglZ . Quantitative binding parameters should be determined using biophysical techniques such as isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR), which provide affinity constants and thermodynamic parameters . Structural characterization of confirmed interactions should be pursued using techniques appropriate to the protein complexes, such as NMR spectroscopy for smaller domains (as was done for the GYF domain) or cryo-electron microscopy for larger assemblies . The functional significance of each interaction should be validated through targeted mutations that specifically disrupt the interaction without affecting protein stability, followed by phenotypic assays measuring focal adhesion formation and motility . To understand the dynamics of the interaction network, researchers should implement time-resolved approaches such as fluorescence recovery after photobleaching (FRAP) or single-molecule tracking to measure association and dissociation kinetics in living cells . Finally, mathematical modeling of the complete interaction network can help integrate the quantitative data and predict system behavior under various perturbations, guiding further experimental design in an iterative process .

How can researchers incorporate advanced imaging techniques to better understand GltJ dynamics in living cells?

Advanced imaging approaches for studying GltJ dynamics in living cells should incorporate multiple complementary techniques that span different spatial and temporal scales. Super-resolution microscopy techniques such as Structured Illumination Microscopy (SIM), Stimulated Emission Depletion (STED), or Photoactivated Localization Microscopy (PALM) can overcome the diffraction limit to resolve individual GltJ clusters within bacterial focal adhesions at nanometer resolution . For studying protein dynamics, Fluorescence Recovery After Photobleaching (FRAP) experiments can measure the turnover rates of GltJ within focal adhesions, providing insights into the stability and exchange kinetics of these structures . Single-particle tracking of photoactivatable or photoconvertible fluorescent protein fusions can reveal the diffusion characteristics and directional movement of individual GltJ molecules, helping to understand how they are recruited to and retained at focal adhesion sites . Multi-color imaging with orthogonal fluorescent tags on different components of the focal adhesion machinery (e.g., GltJ-mNeonGreen and AglZ-mCherry) allows direct visualization of protein co-localization and sequential recruitment . Fluorescence resonance energy transfer (FRET) between appropriately tagged protein pairs can detect direct interactions between GltJ and its binding partners in living cells, providing spatial information about where these interactions occur . For long-term imaging, microfluidic devices that maintain stable growth conditions while allowing changing of media composition can reveal how GltJ dynamics respond to environmental perturbations . Light-inducible dimerization systems (such as CRY2-CIB1) attached to GltJ domains can enable optogenetic control of protein interactions, allowing researchers to precisely trigger specific interactions and observe the resulting changes in focal adhesion dynamics . Finally, correlative light and electron microscopy (CLEM) combines the molecular specificity of fluorescence imaging with the ultrastructural context provided by electron microscopy, revealing how GltJ localization relates to cellular ultrastructure .

What are the most promising approaches for developing GltJ-targeted interventions in bacterial pathogens?

Developing GltJ-targeted interventions against bacterial pathogens represents a promising frontier in antimicrobial research, given the critical role of this protein in bacterial motility and potentially in virulence. Structure-based drug design targeting the GYF domain interaction with the PRS domain of AglZ offers a rational approach, as this interaction has been structurally characterized by NMR spectroscopy and shown to involve a specific binding interface distinct from canonical GYF domains . High-throughput screening campaigns using fluorescence polarization assays with labeled peptides corresponding to the PRS domain of AglZ could identify small molecules that disrupt this protein-protein interaction . The linker region interaction with MglA-GTP represents another druggable target, as disrupting this interaction would prevent proper sensing of the MglA-GTP gradient and thereby disable the molecular switch function of GltJ . CRISPR interference (CRISPRi) targeting gltJ expression could provide a genetic approach to downregulate protein levels without complete gene deletion, potentially avoiding compensatory mechanisms that might arise with complete knockout . Peptide-based inhibitors mimicking critical binding interfaces, such as the GYF domain or linker region, could competitively inhibit GltJ interactions when delivered using appropriate bacterial cell-penetrating peptide sequences . Phage therapy approaches could be engineered to specifically target bacteria expressing surface-exposed regions of GltJ, combining specificity with the amplification capability of bacteriophages . For vaccination strategies, identifying immunogenic epitopes within the periplasmic TonB-C domain could lead to antibodies that bind this region upon bacterial cell envelope disruption . Nanoparticle-based delivery systems conjugated with ligands that specifically bind to GltJ could enable targeted delivery of antimicrobial compounds directly to bacteria expressing this protein . Finally, combination approaches that simultaneously target GltJ and other components of the bacterial focal adhesion machinery could provide synergistic effects while reducing the likelihood of resistance development .

What potential role might GltJ play in bacterial antibiotic resistance mechanisms?

The potential involvement of GltJ in bacterial antibiotic resistance mechanisms represents an underexplored area that merits rigorous investigation from multiple angles. At the cellular level, bacterial focal adhesions facilitated by GltJ enable surface motility, which has been implicated in biofilm formation and dispersal—processes known to contribute significantly to antibiotic tolerance through reduced drug penetration and metabolic adaptations . Gene expression studies comparing antibiotic-resistant and sensitive bacterial strains have occasionally identified upregulation of motility genes, including components of the Agl-Glt complex, suggesting potential adaptive changes in GltJ expression or function during resistance development . The transmembrane nature of GltJ positions it as a potential participant in membrane remodeling responses that occur during antibiotic exposure, particularly for antibiotics targeting cell envelope integrity . The mechanical sensing function of GltJ as a molecular switch could potentially contribute to bacterial mechanotransduction pathways that sense and respond to physical stresses induced by some antibiotics . Protein interaction network analysis suggests that GltJ interacts with elements of the bacterial cytoskeleton through MglA and AglZ, which could influence cellular processes including drug efflux pump positioning or activation . Experimental approaches to investigate these possibilities should include creating antibiotic resistance selection experiments with wild-type versus gltJ mutant strains to determine whether GltJ affects the rate or mechanism of resistance acquisition . Transcriptomic and proteomic profiling of gltJ mutants versus wild-type bacteria following antibiotic challenge could reveal whether GltJ influences stress response pathways involved in resistance . Fluorescence colocalization studies examining the spatial relationship between GltJ-containing focal adhesions and known resistance machinery such as efflux pumps might identify functional connections . Finally, clinical studies comparing gltJ sequence variants or expression levels in resistant versus sensitive clinical isolates could provide translational evidence for GltJ involvement in clinically relevant resistance mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.