Recombinant Glutamate/aspartate transport system permease protein gltK (gltK)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Systems

GltK operates within multisubunit complexes to facilitate nutrient uptake and virulence:

  • Substrate Transport:

    • Mediates high-affinity uptake of glucose and dicarboxylic acids (e.g., glutamate/aspartate) in P. aeruginosa and Burkholderia spp. .

    • Partners with periplasmic binding proteins (e.g., GltB) and ATPases (e.g., GltL) for energy-dependent transport .

  • Virulence:

    • P. aeruginosa GltK deletion mutants exhibit attenuated virulence in Drosophila melanogaster and mouse infection models .

    • Required for effector protein translocation in Burkholderia multivorans during contact-dependent inhibition (CDI) .

Table 2: Functional Pathways Involving GltK

OrganismPathway/ProcessKey PartnersCitation
P. aeruginosaGlucose catabolism, virulenceGltB, GtrS-GltR TCS
Burkholderia spp.CDI effector transportGltJ, BcpA-2
E. coliGlutamate/aspartate uptakeGltJ, GltI

Production and Purification

Recombinant GltK is commercially available with the following specifications:

  • Expression Systems: Optimized in E. coli for high yield (~85% purity via SDS-PAGE) .

  • Product Variants:

    • Full-length (1–224 aa) and partial sequences .

    • Biotinylated versions for interaction studies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please include them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
gltK; Z0803; ECs0692; Glutamate/aspartate import permease protein GltK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
gltK
Target Protein Sequence
MYEFDWSSIVPSLPYLLDGLVITLKITVTAVVIGILWGTMLAVMRLSSFAPVAWFAKAYV NVFRSIPLVMVLLWFYLIVPGFLQNVLGLSPKNDIRLISAMVAFSMFEAAYYSEIIRAGI QSISRGQSSAALALGMTHWQSMKLIILPQAFRAMVPLLLTQGIVLFQDTSLVYVLSLADF FRTASTIGERDGTQVEMILFAGFVYFVISLSASLLVSYLKRRTA
Uniprot No.

Target Background

Function
This protein, gltK, is part of the ABC transporter complex GltIJKL, which is involved in the uptake of glutamate and aspartate. It is believed to be responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: ece:Z0803

STRING: 155864.Z0803

Protein Families
Binding-protein-dependent transport system permease family, HisMQ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Glutamate/aspartate import permease protein GltK and what is its function?

GltK is a membrane protein that functions as part of the ABC transporter complex GltIJKL in Escherichia coli O157:H7. This complex is primarily involved in glutamate and aspartate uptake across the cell membrane. Within this complex, GltK is specifically responsible for the translocation of these amino acid substrates across the bacterial membrane . The protein belongs to the binding-protein-dependent transport system permease family, specifically the HisMQ subfamily , indicating its evolutionary relationship to other similar transport proteins.

What model organisms are typically used for studying GltK?

Escherichia coli O157:H7 is the primary model organism for studying GltK, as this is the species where the protein is naturally expressed . For recombinant expression of GltK, laboratory strains of E. coli such as BL21(DE3) are commonly used due to their high efficiency in protein production and genetic tractability. Other bacterial expression systems may also be employed depending on specific research objectives, particularly when studying the evolutionary conservation of glutamate/aspartate transport mechanisms across different bacterial species.

What are the optimal methods for recombinant expression of GltK?

The recombinant expression of GltK requires careful optimization due to its nature as a membrane protein. While the search results don't provide specific conditions for GltK expression, the application of Design of Experiments (DoE) approaches is highly recommended .

For membrane proteins like GltK, consider the following parameters for optimization:

ParameterRange to TestNotes
Expression systemE. coli strains (BL21, C41, C43)C41 and C43 are engineered for membrane protein expression
Temperature16-37°CLower temperatures (16-25°C) often yield better folding
Induction time3-24 hoursMembrane proteins typically require longer expression times
Inducer concentration0.1-1.0 mM IPTGLower concentrations may reduce aggregation
Media compositionLB, TB, M9 minimalRich media (TB) can increase yield but may affect folding

Rather than testing each factor individually (one-factor-at-a-time approach), use DoE methodology to design a small set of experiments that will reveal both individual effects and interaction effects between factors .

How can Design of Experiments (DoE) approach improve GltK production and purification?

The traditional one-factor-at-a-time approach to optimization is inefficient for complex biological systems like protein expression, as it fails to account for interactions between variables. DoE approaches, in contrast, can predict the effect of each factor and their interactions using a carefully selected small set of experiments .

For GltK production, a factorial design or response surface methodology (RSM) could be employed:

  • Select critical factors: For membrane proteins like GltK, critical factors might include temperature, inducer concentration, expression time, and membrane-mimicking detergents.

  • Design the experiment: Software packages are available that facilitate the choice of DoE approach, design of experiments, and analysis of results .

  • Run the experiments: Following the designed matrix of experimental conditions.

  • Analyze results: Response variables might include protein yield, purity, and functional activity (e.g., substrate binding or transport).

  • Optimize conditions: Based on the statistical analysis, determine optimal conditions for GltK expression and purification.

This systematic approach reduces costs and time compared to traditional methods while yielding more informative results about factor interactions .

How can the function of GltK be assessed within the complete GltIJKL complex?

Assessing GltK function within the complete ABC transporter complex requires approaches that maintain the integrity of the multiprotein complex. Consider these methodological approaches:

  • Co-expression systems: Design a polycistronic expression system containing all four components (GltI, GltJ, GltK, and GltL) of the ABC transporter complex.

  • Functional reconstitution: Purify the complete complex and reconstitute it into proteoliposomes to measure substrate transport directly.

  • Substrate uptake assays: Use radiolabeled glutamate/aspartate to quantify transport activity of the reconstituted complex.

  • Site-directed mutagenesis: Introduce specific mutations in the GltK component to identify critical residues for transport function while maintaining the rest of the complex.

  • Interaction studies: Use techniques such as Blue Native PAGE, chemical crosslinking followed by mass spectrometry, or FRET to assess how GltK interacts with other components of the complex.

A comprehensive functional analysis would require comparison between wild-type and mutant forms of GltK to determine its specific contribution to the transport mechanism.

What are the challenges in crystallizing GltK for structural studies?

Membrane proteins like GltK present significant challenges for crystallization and structural determination. Key challenges and potential solutions include:

  • Protein stability: GltK, as a membrane protein, requires detergents or membrane-mimicking environments to maintain stability. Screen multiple detergents (DDM, LMNG, OG) and lipidic environments.

  • Conformational heterogeneity: Transport proteins often exist in multiple conformational states. Consider using conformation-specific antibodies or nanobodies to stabilize specific conformations.

  • Crystal contacts: Membrane proteins have limited hydrophilic surfaces for crystal contacts. Fusion protein approaches (e.g., T4 lysozyme fusion) can be employed to increase crystallization success.

  • Expression and purification: Obtaining sufficient quantities of pure, homogeneous protein is challenging. Use DoE approaches to optimize expression and purification protocols .

  • Alternative structural methods: Consider cryo-electron microscopy (cryo-EM) as an alternative to crystallography, especially for capturing the complete ABC transporter complex.

A systematic approach to these challenges, potentially using DoE methodology to optimize crystallization conditions, will increase the likelihood of successful structural determination.

How can researchers differentiate between the functional contributions of GltK and other components of the GltIJKL complex?

Distinguishing the specific role of GltK within the GltIJKL complex requires targeted experimental approaches:

  • Component-specific knockouts: Create single-gene deletion mutants for each component and assess the impact on transport activity.

  • Complementation studies: Express wild-type or mutant versions of GltK in knockout strains to restore function.

  • Domain swapping: Engineer chimeric proteins where domains of GltK are swapped with homologous domains from related transporters to identify function-specific regions.

  • Substrate specificity analysis: Determine if mutations in GltK affect the transport specificity for glutamate versus aspartate differently than mutations in other components.

  • ATP hydrolysis coupling: As part of an ABC transporter, evaluate how GltK mutations affect the coupling between ATP hydrolysis by the nucleotide-binding domains and substrate translocation.

These approaches together can provide a comprehensive understanding of GltK's specific contribution to the transport mechanism.

What are the best approaches for analyzing GltK-substrate interactions?

Understanding how GltK interacts with its substrates (glutamate and aspartate) requires specialized techniques:

  • Binding assays: Use isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) to determine binding affinities for substrates.

  • Transport kinetics: Develop reconstituted systems to measure transport rates under varying substrate concentrations to determine Km and Vmax values.

  • Competition assays: Employ structural analogs of glutamate/aspartate to determine binding site specificity.

  • Cysteine scanning mutagenesis: Systematically replace residues in potential substrate binding regions with cysteine, then use chemical modification approaches to probe accessibility.

  • Molecular dynamics simulations: Complement experimental data with computational approaches to model substrate passage through the transport channel.

TechniqueInformation ProvidedAdvantagesLimitations
ITCBinding thermodynamicsDirect measurement of ΔH, ΔS, KdRequires large amounts of protein
MSTBinding affinitiesUses small sample volumesRequires fluorescent labeling
Cysteine scanningAccessibility of residuesMaps the transport pathwayLabor-intensive
MD simulationsDynamic interactionsProvides atomistic detailComputationally intensive

How should researchers interpret conflicting results in GltK functional studies?

When faced with conflicting results in GltK studies, consider the following analytical framework:

  • Experimental context differences: Compare the specific experimental conditions, including expression systems, purification methods, and functional assay conditions.

  • Protein state variability: Evaluate whether different oligomeric states or conformations of GltK were being studied in conflicting reports.

  • Complex integrity: Assess whether the complete GltIJKL complex was intact in different studies, as isolated GltK may behave differently.

  • Post-translational modifications: Consider whether differences in post-translational modifications might explain functional variations.

  • Statistical robustness: Review the statistical analyses applied and sample sizes used in conflicting studies.

When publishing new findings, include a comprehensive comparison with existing literature and explicitly address any discrepancies using this analytical framework.

What statistical approaches are most appropriate for analyzing DoE data in GltK optimization studies?

Statistical analysis of DoE data for GltK optimization should follow these best practices:

  • Model selection: Choose between linear, interaction, or quadratic models based on the experimental design and expected relationships.

  • ANOVA testing: Use Analysis of Variance to determine the significance of factors and their interactions.

  • Response surface methodology (RSM): For optimization studies, RSM can be used to identify optimal conditions through mathematical models and surface plots .

  • Residual analysis: Examine residual plots to validate model assumptions of normality, homoscedasticity, and independence.

  • Validation experiments: Confirm optimized conditions with validation runs, comparing observed responses with model predictions.

Most DoE software packages provide integrated statistical analysis tools that guide researchers through appropriate statistical approaches based on the experimental design chosen .

What emerging techniques could advance our understanding of GltK function and structure?

Several cutting-edge techniques could significantly enhance GltK research:

  • Single-molecule FRET: To observe conformational changes during the transport cycle in real-time.

  • Cryo-EM: For structural determination of the complete GltIJKL complex in different functional states.

  • Native mass spectrometry: To analyze the stoichiometry and stability of the GltIJKL complex.

  • In-cell NMR: To study GltK dynamics in a native-like environment.

  • Advanced computational approaches: Including AlphaFold2 for structure prediction and enhanced sampling methods for simulating the complete transport cycle.

  • CRISPR-based approaches: For precise genome editing to study GltK function in its native genomic context.

These approaches, especially when combined, could resolve current knowledge gaps regarding GltK's precise role in substrate recognition and translocation mechanism.

How might comparative studies between GltK and homologous proteins inform transporter mechanism research?

Comparative studies between GltK and related transporters can provide valuable evolutionary and functional insights:

  • Phylogenetic analysis: Construct evolutionary trees of ABC transporter permeases to identify conserved functional domains.

  • Structure-function correlations: Compare crystal structures (when available) of homologous proteins to identify common structural elements required for transport.

  • Substrate specificity determinants: Identify residues that differ between GltK and related transporters with different substrate preferences.

  • Chimeric protein studies: Engineer fusion proteins containing domains from GltK and homologous transporters to map functional regions.

  • Cross-species complementation: Test whether GltK homologs from different bacterial species can functionally substitute for each other.

This comparative approach can reveal evolutionary conservation and specialization patterns, providing broader insights into the mechanisms of substrate recognition and transport in ABC transporter systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.