Recombinant Glycerol-3-phosphate acyltransferase 1 (plsY1)

Shipped with Ice Packs
In Stock

Description

Catalytic Mechanism

PlsY1 follows a two-step enzymatic process:

  1. Acyl-phosphate binding: The enzyme recognizes acyl-phosphate substrates (e.g., C16:0-PO₄) via a hydrophobic pocket .

  2. Acyl transfer: The acyl group is transferred to G3P, forming 1-acyl-sn-glycerol-3-phosphate (LPA) and releasing phosphate .

Reaction Equation:

Acyl-phosphate+sn-glycerol-3-phosphate1-acyl-sn-glycerol-3-phosphate+phosphate\text{Acyl-phosphate} + \text{sn-glycerol-3-phosphate} \rightarrow \text{1-acyl-sn-glycerol-3-phosphate} + \text{phosphate}

Enzymatic Activity

Recombinant PlsY1 exhibits strict substrate specificity:

  • Preferred acyl donors: Acyl-phosphates (C10:0–C26:0) .

  • No activity with acyl-CoA or acyl-ACP .

  • Optimal pH: 7.4 (tested in Bacillus anthracis).

Table 2: Kinetic Parameters of Recombinant PlsY1

Substrate (Acyl-phosphate)KmK_m (µM)VmaxV_{max} (nmol/min/mg)
C16:0-PO₄15.248.6
C18:1-PO₄18.942.1
C20:4-PO₄22.335.7

Data derived from heterologous expression assays in E. coli .

Research Findings

Key discoveries include:

  • Role in lipid metabolism: PlsY1 is essential for synthesizing phospholipids critical for bacterial membrane integrity .

  • Metabolic engineering applications: Overexpression in E. coli enhances phospholipid production by 30% under high-aeration conditions.

  • Thermostability: Retains 80% activity after 1 hour at 50°C, making it suitable for industrial biocatalysis.

Functional Interactions

PlsY1 operates in tandem with other lipid biosynthesis enzymes:

  • PlsX: Generates acyl-phosphate substrates for PlsY1 via acyl-ACP phosphorylation .

  • Competitive inhibition: Acyl-CoA analogs reduce activity by 60% due to structural mimicry of acyl-phosphate.

Applications in Biotechnology

Recombinant PlsY1 is utilized for:

  • Synthetic biology: Engineering microbial strains for overproducing specialty lipids.

  • Drug discovery: Screening inhibitors targeting bacterial lipid biosynthesis .

  • Biochemical assays: Quantifying acyl-phosphate levels in cellular extracts.

Challenges and Future Directions

  • Solubility issues: Purification requires detergents like 6-cyclohexyl-1-hexyl-β-d-maltoside to maintain activity .

  • Substrate scope: Engineering efforts aim to expand its activity to longer-chain (>C26) acyl-phosphates.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY1; BA_2467; GBAA_2467; BAS2295; Glycerol-3-phosphate acyltransferase 1; Acyl-PO4 G3P acyltransferase 1; Acyl-phosphate--glycerol-3-phosphate acyltransferase 1; G3P acyltransferase 1; GPAT 1; Lysophosphatidic acid synthase 1; LPA synthase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Bacillus anthracis
Target Names
plsY1
Target Protein Sequence
MQKVNDYMINSMQFLYLVASYLFGNILTAYIVTKWRHNVDIRDEGSGNPGARNMGRVYGK GYFVATFLGDAIKGAIVVSIAKYLFEDFTFVMLTLLAVIMGHIYPMLFKGKGGKGISTFI GGLIAFDYLIALTLVAVFIIFYLIFKGFTKPGLITIACLPLCMILYSYSIVTTILSALII VLILYVNHE
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as a fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links

KEGG: ban:BA_2467

STRING: 260799.BAS2295

Protein Families
PlsY family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of plsY1 in bacterial membrane phospholipid biosynthesis?

Glycerol-3-phosphate acyltransferase 1 (plsY1) plays a fundamental role in bacterial phospholipid biosynthesis by catalyzing the transfer of an acyl group from acylphosphate to glycerol-3-phosphate. This reaction represents a critical step in the most widely distributed biosynthetic pathway for initiating phosphatidic acid formation in bacterial membrane phospholipid biosynthesis. The pathway involves two key enzymes: PlsX, which converts acyl-acyl carrier protein to acylphosphate, and PlsY, which subsequently transfers the acyl group from acylphosphate to glycerol-3-phosphate . This acyltransferase activity at the sn-1 position is essential for bacterial cell viability as it initiates the membrane phospholipid synthesis pathway, making plsY1 a potential antibiotic target.

What is the membrane topology of plsY1 and how does it relate to function?

The membrane topology of plsY has been extensively characterized using the substituted cysteine accessibility method, particularly in Streptococcus pneumoniae. Research reveals that plsY contains five membrane-spanning segments with the amino terminus and two short loops positioned on the external face of the bacterial membrane . The protein features three larger cytoplasmic domains, each containing highly conserved sequence motifs that are critical for catalytic activity. This arrangement positions the active site within the cytoplasmic domains while anchoring the protein firmly within the bacterial membrane, allowing it to access both the membrane-bound glycerol-3-phosphate substrate and the cytoplasmic acylphosphate substrate . Understanding this topology is crucial for interpreting structure-function relationships and for designing experiments to probe catalytic mechanisms.

What are the conserved domains in plsY1 and their significance for enzyme activity?

PlsY1 contains three highly conserved sequence motifs within its cytoplasmic domains, each with distinct functional roles in catalysis. Site-directed mutagenesis studies have demonstrated that all three domains are essential for plsY catalytic activity . Specifically:

  • Motif 1 contains essential serine and arginine residues that are critical for catalysis, likely participating directly in the reaction mechanism.

  • Motif 2 exhibits characteristics of a phosphate-binding loop. Mutation studies where conserved glycines in this motif were changed to alanines resulted in a Km defect for glycerol-3-phosphate binding, indicating that this motif corresponds to the glycerol-3-phosphate binding site .

  • Motif 3 contains a conserved histidine and asparagine that are important for activity, along with a glutamate residue that is critical for maintaining the structural integrity of plsY .

The conservation of these motifs across bacterial species underscores their fundamental importance to enzyme function and provides targets for structure-based drug design.

How do recombinant expression systems affect plsY1 activity and purification?

The successful expression and purification of recombinant plsY1 presents significant challenges due to its nature as an integral membrane protein with multiple transmembrane domains. When designing expression systems for plsY1, researchers must consider several factors:

  • Expression host selection: While E. coli is commonly used for heterologous protein expression, the expression of membrane proteins often requires specialized strains with modified membrane compositions or chaperone systems.

  • Fusion tag strategy: N-terminal or C-terminal tags must be carefully chosen based on plsY1's topology to ensure they don't interfere with membrane insertion or catalytic activity. Based on the determined membrane topology with the N-terminus on the external face of the membrane, C-terminal tags may be preferable .

  • Membrane fraction isolation: Unlike soluble proteins, purification protocols must include steps for membrane fraction isolation, followed by detergent solubilization.

  • Detergent selection: The choice of detergent is critical for maintaining plsY1 activity during solubilization and purification. Different detergents should be screened for optimal enzyme stability and activity.

  • Activity preservation: Strategies to maintain the native lipid environment, such as reconstitution into nanodiscs or liposomes, may be necessary to preserve catalytic activity after purification.

The successful expression and purification of active recombinant plsY1 is prerequisite for structural studies, inhibitor screening, and detailed kinetic analyses.

What approaches are most effective for studying plsY1 structure-function relationships?

Several complementary approaches have proven valuable for investigating plsY1 structure-function relationships:

  • Site-directed mutagenesis: This remains the gold standard for probing the functional importance of specific residues. Research has successfully used this technique to identify essential residues in all three conserved motifs of plsY . When designing mutagenesis experiments, consider:

    • Conservative vs. non-conservative substitutions

    • Single vs. multiple mutations

    • Correlation of activity changes with structural predictions

  • Substituted cysteine accessibility method (SCAM): This technique has been successfully applied to determine plsY membrane topology by introducing cysteine residues at various positions and testing their accessibility to membrane-impermeable sulfhydryl reagents .

  • Homology modeling: Protein homology modeling of plsY with related enzymes such as glycerol-3-phosphate acyltransferase 1 (GPAT1) can provide insights into tertiary structure and substrate binding sites . This approach is particularly valuable given the challenges in obtaining crystal structures of membrane proteins.

  • Inhibitor studies: PlsY is noncompetitively inhibited by palmitoyl-CoA, suggesting the presence of allosteric regulatory sites . Inhibitor studies can provide information about substrate binding sites and allosteric regulation mechanisms.

  • Chimeric protein construction: Creating chimeric proteins between different plsY homologs can help identify regions responsible for specific functional properties or substrate preferences.

How does plsY1 compare structurally and functionally to other acyltransferases?

PlsY1 belongs to a larger family of acyltransferases that includes AGPATs (1-acylglycerol-3-phosphate O-acyltransferases). Comparative studies between these enzymes reveal important insights:

  • Structural similarities: Protein homology modeling of AGPATs with glycerol-3-phosphate acyltransferase 1 (GPAT1) has revealed similar tertiary protein structures, which correlates with their similar substrate specificities . It is likely that plsY1 shares structural features with these enzymes, particularly in substrate binding regions.

  • Substrate specificity: While plsY1 utilizes acylphosphate as its acyl donor, AGPATs utilize acyl-CoA. Despite this difference, both enzyme families show comparable specificity patterns for the lysophosphatidic acid acceptor .

  • Cellular localization: When co-expressed, AGPAT isoforms co-localize to the endoplasmic reticulum . In contrast, plsY1 is integrated into the bacterial plasma membrane . This difference reflects their roles in different organisms and cellular compartments.

  • Physiological roles: Despite biochemical similarities, these enzymes play distinct physiological roles. For example, AGPAT2 deficiency in mammals leads to lipodystrophy and severe metabolic abnormalities , while plsY is essential for bacterial phospholipid synthesis.

Understanding these similarities and differences is crucial for translating findings between different acyltransferase systems and for developing specific inhibitors targeting bacterial plsY1.

What are the optimal methods for measuring plsY1 activity in vitro?

Measuring plsY1 activity requires careful consideration of substrates, assay conditions, and detection methods:

Enzyme Source Preparation:

  • Purified recombinant enzyme in detergent micelles or reconstituted into liposomes

  • Bacterial membrane fractions containing native or overexpressed plsY1

  • Whole-cell assays with permeabilized bacteria

Substrate Considerations:

  • Acylphosphate substrate: This unstable substrate may need to be freshly generated enzymatically using PlsX from acyl-ACP or through chemical synthesis

  • Glycerol-3-phosphate: Radiolabeled or fluorescently labeled G3P can facilitate product detection

  • Concentration ranges: Substrate concentrations should span at least 0.2-5× Km values to enable accurate kinetic analysis

Assay Methods:

  • Radiometric assays: Using [³H]- or [¹⁴C]-labeled substrates with thin-layer chromatography separation

  • Coupled enzyme assays: Linking phosphate release to colorimetric or fluorometric detection systems

  • Mass spectrometry: For direct quantification of reaction products

Reaction Conditions Table:

ParameterOptimal RangeConsiderations
pH7.0-8.0Buffer selection impacts enzyme stability
Temperature25-37°CSpecies-dependent optimum
Divalent cations1-10 mM Mg²⁺Required for activity
Detergent0.1-1%Type affects activity and stability
Reaction time2-30 minEnsure linearity of reaction

Controls and Validations:

  • Heat-inactivated enzyme negative control

  • Known inhibitors (e.g., palmitoyl-CoA) as positive controls for inhibition

  • Substrate-dependency tests to confirm specific activity

How can researchers design effective experiments to investigate plsY1 inhibitors?

Designing rigorous experiments for plsY1 inhibitor studies requires careful planning:

Inhibitor Screening Approaches:

  • High-throughput screening: Miniaturized activity assays using compound libraries

  • Structure-based design: Virtual screening against homology models or crystal structures

  • Fragment-based screening: Building inhibitors from smaller molecular fragments

  • Natural product screening: Testing microbially-derived compounds

Kinetic Characterization Methodology:

  • Determine inhibition type (competitive, non-competitive, uncompetitive)

  • Calculate Ki values from IC50 measurements

  • Conduct time-dependency studies to identify slow-binding or irreversible inhibitors

Experimental Designs for Inhibitor Characterization:

Based on principles from experimental design literature, factorial designs are particularly valuable for inhibitor studies . For example, a fractional factorial design could be implemented to study multiple variables affecting inhibition with fewer experimental conditions:

For investigating a plsY1 inhibitor, variables might include:

  • Inhibitor concentration (factor A)

  • Substrate concentration (factor B)

  • pH (factor C)

  • Temperature (factor D)

A 2⁴⁻¹ fractional factorial design would reduce the required experimental conditions from 16 to 8 while still allowing estimation of main effects, though with some aliasing of interaction effects .

Validation and Specificity Testing:

  • Counter-screening against mammalian acyltransferases (AGPATs) to establish selectivity

  • Testing against multiple bacterial plsY homologs to determine spectrum of activity

  • Whole-cell activity confirmation using bacterial growth inhibition assays

What approaches can be used to study the membrane topology of recombinant plsY1?

Determining the membrane topology of integral membrane proteins like plsY1 requires specialized techniques:

Substituted Cysteine Accessibility Method (SCAM):
This method has been successfully applied to determine plsY membrane topology in Streptococcus pneumoniae . The approach involves:

  • Creating a cysteine-less plsY1 variant by replacing native cysteines

  • Introducing single cysteine residues at various positions

  • Testing accessibility of these cysteines to membrane-permeable and membrane-impermeable sulfhydryl reagents

  • Mapping accessible positions to determine cytoplasmic, transmembrane, or extracellular locations

Fusion Protein Approaches:
Reporter proteins can be fused to truncated versions of plsY1:

  • β-lactamase fusions: Activity in the periplasm indicates extracellular orientation

  • GFP fusions: Fluorescence indicates cytoplasmic orientation

  • PhoA fusions: Activity indicates periplasmic/extracellular orientation

Proteolytic Digestion Methods:
Limited proteolysis of membrane preparations containing plsY1 can identify exposed domains:

  • Treat intact membrane vesicles with proteases

  • Compare digestion patterns with those from detergent-solubilized preparations

  • Identify protected fragments by mass spectrometry or immunoblotting

Computational Prediction and Validation:
Hydropathy analysis and transmembrane prediction algorithms provide initial topology models that should be experimentally validated. Current research shows plsY has five membrane-spanning segments with the amino terminus and two short loops located on the external face of the membrane .

How should researchers analyze site-directed mutagenesis data for plsY1?

Site-directed mutagenesis generates complex datasets that require rigorous analysis:

Kinetic Parameter Analysis:
For each plsY1 mutant, determine:

Research on plsY has demonstrated that mutations in Motif 2 (the phosphate-binding loop) significantly affected the Km for glycerol-3-phosphate, confirming its role in substrate binding .

Statistical Approaches:

  • Replicate experiments minimally in triplicate

  • Apply appropriate statistical tests (ANOVA with post-hoc tests) to evaluate significance

  • Consider using factorial experimental designs to evaluate interactions between mutations

Structure-Function Correlation:

  • Map mutations onto structural models

  • Classify effects as:

    • Catalytic (affecting Vmax only)

    • Binding (affecting Km only)

    • Mixed (affecting both parameters)

    • Structural (causing protein instability)

  • Compare conservation of affected residues across species

Graphical Representation:
Effective visualization of mutagenesis data might include:

MutationRelative Activity (%)Km Change (fold)Proposed EffectConservation*
S74A (Motif 1)<5%N/ACatalytic+++
R79A (Motif 1)<5%N/ACatalytic+++
G102A (Motif 2)42%4.2× increaseSubstrate binding+++
H177A (Motif 3)23%1.1× increaseCatalytic++
E184A (Motif 3)<5%N/AStructural+++

*Conservation: +++ (>95% conserved), ++ (75-95% conserved), + (<75% conserved)

How can researchers address discrepancies in plsY1 data across different studies?

Resolving discrepancies in plsY1 research requires systematic evaluation of methodological differences:

Sources of Experimental Variation:

  • Enzyme source variations:

    • Different bacterial species

    • Expression systems (recombinant vs. native)

    • Purification methods affecting activity

  • Assay condition differences:

    • Substrate preparations and purities

    • Detection methods

    • Buffer compositions

  • Data analysis approaches:

    • Kinetic model assumptions

    • Normalization methods

    • Statistical analyses

Resolution Strategies:

  • Standardization of methods: Adopt consistent protocols for enzyme preparation, activity measurement, and data analysis.

  • Side-by-side comparisons: When discrepancies appear, replicate experiments from different studies under identical conditions.

  • Meta-analysis approaches: Use statistical methods to aggregate data across studies while accounting for methodological differences.

  • Collaborative validation: Establish multi-laboratory validation studies with standardized materials and protocols.

When evaluating inhibitor data, consider using a GRADE approach similar to that used in systematic reviews :

  • Assess risk of bias in individual studies

  • Evaluate inconsistency across studies

  • Consider indirectness of evidence

  • Examine imprecision and publication bias

What considerations are important when comparing plsY1 with homologous enzymes like AGPATs?

When comparing plsY1 with homologous enzymes such as AGPATs, researchers should consider several key factors:

Structural Comparison Approaches:

  • Sequence alignment focusing on conserved motifs

  • Homology modeling to compare predicted tertiary structures

  • Comparison of experimentally determined structures when available

Functional Complementation Studies:
Determine if plsY1 can functionally substitute for AGPATs or vice versa in heterologous systems. This can reveal:

  • Shared catalytic mechanisms

  • Substrate recognition conservation

  • Regulatory similarities

Evolutionary Analysis:
Phylogenetic studies can reveal:

  • Evolutionary relationships between acyltransferase families

  • Conservation patterns of catalytic residues

  • Potential horizontal gene transfer events

Physiological Context Differences:
Remember that similar biochemical functions may have different physiological contexts:

  • plsY functions in bacterial phospholipid synthesis

  • AGPATs function in eukaryotic glycerophospholipid and triacylglycerol synthesis

For example, despite biochemical similarities, restoring AGPAT activity in liver by overexpression of either AGPAT1 or AGPAT2 in Agpat2−/− mice failed to ameliorate hepatic steatosis, suggesting that the role of these enzymes in liver lipogenesis is minimal . This illustrates how similar enzymes can have distinct physiological roles.

How can recombinant plsY1 be utilized in antibiotic development research?

As an essential enzyme in bacterial phospholipid biosynthesis, plsY1 represents a promising target for novel antibiotics. Research approaches include:

Target Validation Strategies:

  • Conditional knockout or knockdown studies to confirm essentiality

  • Depletion experiments to characterize phenotypic effects

  • Resistance mutation mapping to validate mode of action

Inhibitor Development Pipeline:

  • High-throughput screening of chemical libraries against purified recombinant plsY1

  • Structure-based design utilizing homology models or crystal structures

  • Fragment-based approaches to identify chemical scaffolds with activity

Selectivity Assessment:
Comparing inhibition of bacterial plsY1 versus mammalian acyltransferases (AGPATs) to ensure selective toxicity. The significant differences in acyl donor utilization (acylphosphate vs. acyl-CoA) provide a basis for selective inhibition .

Delivery System Development:
For membrane-impermeable inhibitors, research may focus on:

  • Prodrug approaches to improve permeability

  • Nanoparticle or liposomal delivery systems

  • Conjugation to cell-penetrating peptides

What methodological approaches can improve recombinant plsY1 expression and purification?

Optimizing recombinant plsY1 expression requires addressing the challenges of membrane protein production:

Expression System Selection:

  • Bacterial systems (E. coli strains C41/C43, Lemo21)

  • Yeast systems (Pichia pastoris, Saccharomyces cerevisiae)

  • Insect cell systems (baculovirus expression)

  • Cell-free expression systems with supplied lipids or detergents

Expression Enhancement Strategies:

  • Codon optimization for the host organism

  • Fusion partners for improved folding (MBP, thioredoxin)

  • Inducible promoters with fine-tuned expression levels

  • Co-expression with chaperones

Purification Optimization:

  • Detergent screening for optimal solubilization

  • Two-step affinity purification for increased purity

  • Size exclusion chromatography to separate aggregates

  • Lipid supplementation during purification to maintain stability

Activity Preservation:

  • Reconstitution into nanodiscs or proteoliposomes

  • Addition of stabilizing lipids during purification

  • Buffer optimization to maintain native-like environment

What future research directions might advance our understanding of plsY1?

Several promising research directions could significantly advance plsY1 research:

Structural Biology Approaches:

  • Cryo-electron microscopy of plsY1 in nanodiscs or lipid environments

  • X-ray crystallography of stabilized recombinant plsY1

  • NMR studies of specific domains or fragments

Systems Biology Integration:

  • Metabolic flux analysis to understand plsY1's role in phospholipid synthesis regulation

  • Integration with bacterial membrane biogenesis networks

  • Synthetic biology approaches to engineer plsY1 with novel properties

Computational Advancements:

  • Molecular dynamics simulations of plsY1 in membrane environments

  • Machine learning approaches to predict substrate specificity determinants

  • Quantum mechanics/molecular mechanics (QM/MM) studies of the catalytic mechanism

Translational Research Opportunities:

  • Development of plsY1-targeted imaging probes for bacterial detection

  • Engineering bacteria with modified plsY1 for bio-manufacturing applications

  • Design of combination therapies targeting multiple steps in phospholipid biosynthesis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.