Recombinant Glycerol-3-phosphate acyltransferase 2 (plsY2)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

plsY2 is produced via heterologous expression in Escherichia coli, enabling high-yield synthesis for research applications:

ParameterSpecification
Expression SystemE. coli (in vitro) .
Purity>85% (verified by SDS-PAGE) .
Storage ConditionsLyophilized or liquid form at -20°C/-80°C .
Product CodesCSB-CF670294DAAG (Dehalococcoides), CSB-EP882700DJA1-B (Deinococcus) .

This recombinant approach ensures consistent enzyme activity and scalability for biochemical studies .

Enzymatic Activity and Substrate Specificity

plsY2 exhibits unique regiospecificity compared to eukaryotic GPATs:

  • sn-2 Acylation Preference: Unlike most mammalian GPATs, which acylate G3P at the sn-1 position, plsY2 and related bacterial isoforms favor sn-2 acylation, producing sn-2 MAG or LPA .

  • Bifunctional Activity: Some plsY2 homologs (e.g., GPAT4/6 in plants) possess dual acyltransferase/phosphatase activity, directly generating MAG without LPA intermediates .

  • Role in Lipid Remodeling: Incorporation of long-chain fatty acids like docosahexaenoic acid (DHA) into triglycerides and phospholipids is facilitated by plsY2 activity .

4.1. Lipid Biosynthesis Studies

  • DHA-Rich Glycerolipid Production: plsY2 homologs in marine protists (e.g., Aurantiochytrium limacinum) are essential for synthesizing DHA-enriched triglycerides, critical for nutraceutical and pharmaceutical industries .

  • Membrane Permeability Modulation: GPAT2 (a mammalian mitochondrial isoform) influences cancer cell membrane roughness and permeability, suggesting plsY2 could serve as a model for studying lipid-driven oncogenesis .

4.2. Industrial Biotechnology

  • Biofuel Precursor Synthesis: plsY2’s ability to esterify G3P with diverse acyl groups makes it a candidate for engineering microbial lipid production .

Future Directions

  • Structural Resolution: Crystallographic studies of plsY2 could elucidate mechanisms behind its sn-2 preference and phosphatase activity .

  • Metabolic Engineering: Optimizing plsY2 expression in industrial microbes may enhance polyunsaturated fatty acid (PUFA) production .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery times may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize development with your specified tag.
Synonyms
plsY2; BA_3374; GBAA_3374; BAS3128; Glycerol-3-phosphate acyltransferase 2; Acyl-PO4 G3P acyltransferase 2; Acyl-phosphate--glycerol-3-phosphate acyltransferase 2; G3P acyltransferase 2; GPAT 2; Lysophosphatidic acid synthase 2; LPA synthase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Bacillus anthracis
Target Names
plsY2
Target Protein Sequence
MNILTLILSYLIGSISFALIVGKMFYKKDIRDYGSGNLGATNAYRVLGIKAGVIVAIADI LKGTFACLLPLILSSTINPIVCGLLAILGHIFSVFASFKGGKAVATATGVFLFLSPLGVL VGFVVFVLTLLFTKYVSLSSMLAGIALFIYSLIFEDKVIIALSLLIIVSIIILHRQNIKR ILNGTENKIV
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor but does not utilize acyl-CoA or acyl-ACP.
Database Links

KEGG: ban:BA_3374

STRING: 260799.BAS3128

Protein Families
PlsY family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Glycerol-3-phosphate acyltransferase 2 and what is its primary biochemical function?

Glycerol-3-phosphate acyltransferase 2 (GPAT2) catalyzes the initial and rate-limiting step in glycerolipid synthesis by acylating glycerol-3-phosphate. It is one of several mammalian GPAT isoforms that have been identified, with GPAT2 specifically being a mitochondrial isoform primarily expressed in testis under physiological conditions. The protein has a calculated mass of 88.8 kDa and shows approximately 27% amino acid identity to GPAT1, another mitochondrial isoform. GPAT2's enzymatic activity transfers fatty acids to glycerol-3-phosphate (G3P), forming lysophosphatidic acid (LPA), which serves as a precursor for subsequent glycerolipid synthesis .

Where is GPAT2 expressed under normal physiological conditions?

GPAT2 shows tissue-specific expression patterns, with remarkably high expression in testis. Research indicates that testicular mRNA expression is approximately 50-fold higher than in liver or brown adipose tissue. Within the testis, Gpat2 mRNA is expressed specifically in primary spermatocytes, with the protein also being detected in later stages of spermatogenesis. This pronounced tissue specificity suggests GPAT2 has specialized functions in reproductive tissues. Unlike GPAT1, GPAT2 mRNA abundance in liver does not respond to nutritional changes such as fasting or refeeding, further underscoring its distinct physiological role .

How does GPAT2 differ from other GPAT isoforms structurally and functionally?

GPAT2 differs from other GPAT isoforms in several key aspects:

  • Structural differences: GPAT2 encodes a protein of 798 amino acids with only 27% amino acid identity to GPAT1, despite both being mitochondrial isoforms.

  • Sensitivity to inhibitors: GPAT2 is an N-ethylmaleimide (NEM)-sensitive isoform, unlike GPAT1 which is NEM-resistant.

  • Substrate preference: GPAT2 shows specificity for arachidonoyl-CoA as a substrate, whereas other GPAT isoforms may have different fatty acid preferences.

  • Regulation: Unlike GPAT1, GPAT2 expression is not regulated by nutritional status (fasting/refeeding).

  • Cellular location: While both GPAT1 and GPAT2 are located in mitochondria, they appear to have distinct functions within this organelle .

What methods can be used to confirm successful expression of recombinant GPAT2?

To confirm successful expression of recombinant GPAT2, researchers can employ several complementary approaches:

  • Western blotting: Using polyclonal antibodies against GPAT2 to detect the expressed protein. Research shows that recombinant GPAT2 expressed in Cos-7 cells appears as an 80 kDa band, while in vitro translation produces an 89 kDa product.

  • Enzymatic activity assays: Measuring NEM-sensitive GPAT activity, which typically increases by approximately 30% in cells transiently transfected with GPAT2.

  • Subcellular localization: Confirming mitochondrial localization using confocal microscopy with appropriate mitochondrial markers.

  • Metabolic labeling: Assessing incorporation of radiolabeled fatty acids (such as [1-¹⁴C]oleate or [1-¹⁴C]arachidonate) into triacylglycerols (TAG), which increases substantially in GPAT2-expressing cells .

  • Purity assessment: SDS-PAGE analysis to confirm greater than 85% purity of the recombinant protein .

How does GPAT2 contribute to specific lipid profiles and what are the implications for cellular function?

GPAT2 plays a crucial role in establishing specific cellular lipid profiles, particularly regarding polyunsaturated fatty acids. When overexpressed in CHO-K1 cells, GPAT2 demonstrates a marked preference for arachidonoyl-CoA as a substrate, increasing both GPAT and AGPAT (acylglycerolphosphate acyltransferase) activities 2-fold with this substrate. This specificity results in the incorporation of arachidonic acid into triacylglycerols, which is not observed in control cells. Similarly, in Aurantiochytrium limacinum, the PLAT2 enzyme (a GPAT2 homolog) preferentially incorporates docosahexaenoic acid (DHA, 22:6n-3) into glycerolipids .

The functional implications of these specific lipid profiles include:

  • Membrane properties: GPAT2 expression alters cell surface topography, resulting in rougher membrane surfaces with fewer pore-like structures and less membrane damage.

  • Specialized tissue functions: In testis, GPAT2-mediated lipid metabolism appears tightly coordinated with reproductive development, as TAG content and arachidonic acid content peak coincidentally with GPAT2 expression during sexual maturation.

  • Cancer phenotypes: GPAT2 overexpression in several cancer types may contribute to altered membrane properties that support tumor cell survival and proliferation .

What experimental approaches can be used to study the substrate specificity of GPAT2 in vitro and in vivo?

Studying GPAT2 substrate specificity requires multiple complementary approaches:

In vitro approaches:

  • Recombinant enzyme assays: Using purified recombinant GPAT2 with various acyl-CoA substrates to measure activity rates. For example, researchers have demonstrated GPAT2's preference for arachidonoyl-CoA by showing 2-fold higher activity with this substrate compared to other acyl-CoAs.

  • Microsomal/mitochondrial fraction assays: Isolating subcellular fractions from GPAT2-expressing cells and assessing activity with different substrates under varying conditions (pH, temperature, cofactors).

  • Site-directed mutagenesis: Identifying and modifying key residues potentially involved in substrate recognition and catalysis, then measuring changes in substrate preference.

In vivo approaches:

  • Metabolic labeling: Incubating GPAT2-expressing cells with radiolabeled fatty acids and tracking their incorporation into different lipid classes. Studies show that [1-¹⁴C]arachidonate incorporation into TAG increases by 40% in GPAT2-transfected cells.

  • Lipidomic analysis: Employing gas-liquid chromatography or mass spectrometry to analyze changes in lipid profiles in response to GPAT2 expression or silencing. This approach has revealed arachidonic acid presence in the TAG fraction of GPAT2-overexpressing cells but not in control cells.

  • Gene knockout/knockdown studies: Analyzing how GPAT2 disruption affects lipid composition in relevant tissues or cell models .

What are the implications of GPAT2 overexpression in cancer cells and how can this be experimentally investigated?

GPAT2 is overexpressed in several cancer types and cancer-derived human cell lines, where it appears to contribute to the tumor phenotype. Research indicates several important implications of this overexpression:

  • Altered membrane properties: GPAT2 expression influences cell surface topography and roughness, creating membrane characteristics that may support cancer cell survival and proliferation.

  • Decreased membrane damage: Cancer cells expressing GPAT2 show less membrane damage than those with silenced GPAT2, potentially enhancing their viability.

  • Modified lipid metabolism: GPAT2 alters arachidonic acid content in glycerolipids, which may influence inflammatory signaling and other cancer-related processes.

Experimental investigation approaches:

  • Expression correlation studies: Analyzing GPAT2 expression levels across cancer types and stages, correlating with clinical outcomes.

  • Functional studies: Using gene silencing or overexpression in cancer cell lines to assess effects on proliferation, migration, invasion, and resistance to apoptosis.

  • Atomic force microscopy (AFM): Measuring changes in cell surface properties related to GPAT2 expression. This technique has successfully quantified differences in membrane roughness and identified pore-like structures in GPAT2-silenced cells.

  • Membrane damage assays: Measuring lactate dehydrogenase release to assess membrane integrity in relation to GPAT2 expression.

  • Lipidomic profiling: Comprehensive analysis of lipid composition changes resulting from GPAT2 modulation in cancer cells .

How does GPAT2 coordinate with other enzymes in glycerolipid synthesis pathways?

GPAT2 functions as part of a complex enzymatic network in glycerolipid synthesis. Its coordination with other enzymes can be understood through several observations:

  • Sequential enzymatic processing: GPAT2 catalyzes the first step by generating LPA, which is subsequently processed by other enzymes. In Aurantiochytrium limacinum, PLAT2 (a GPAT2 homolog) produces DHA-containing LPA (LPA 22:6), which leads to the production of DHA-containing diacylglycerol (DG 44:12) and subsequently various DHA-rich triacylglycerols and phospholipids.

  • Compensatory mechanisms: When GPAT2 is silenced, other enzymes may partially compensate for its function. For instance, the lack of GPAT2 appears to be partially offset by the overexpression of AGPAT11, another arachidonic-acid-metabolizing enzyme.

  • Pathway selectivity: GPAT2-generated intermediates appear directed toward specific downstream pathways. In overexpression studies, DHA-containing diacylglycerols are preferentially converted to specific triacylglycerol and phosphatidylcholine species, while DHA-free diacylglycerols follow different metabolic fates.

  • Developmental coordination: In testis, GPAT2 expression and activity correlate with specific developmental stages, suggesting coordinated regulation with other enzymes involved in spermatogenesis .

What expression systems are most effective for producing functional recombinant GPAT2?

Multiple expression systems have been successfully employed for producing functional recombinant GPAT2, each with specific advantages depending on research objectives:

Expression SystemAdvantagesConsiderationsApplications
E. coliHigh yield, cost-effective, rapid productionMay lack proper folding or post-translational modificationsStructural studies, antibody production
Yeast (S. cerevisiae)Eukaryotic processing, higher likelihood of proper foldingLower yield than bacterial systemsFunctional studies, protein-protein interactions
BaculovirusInsect cell expression, good for membrane proteinsMore complex system, longer production timeEnzymatic activity assays, structural studies
Mammalian cells (Cos-7, CHO-K1)Native-like processing, confirmed functional activityLower yield, higher costIn vivo function studies, substrate specificity

Key methodological considerations:

  • For functional studies, mammalian expression systems have demonstrated success, with both Cos-7 and CHO-K1 cells showing increased GPAT activity upon GPAT2 transfection.

  • For purification purposes, adding appropriate tags (His, FLAG) facilitates isolation while minimizing interference with enzymatic activity.

  • Regardless of the system used, confirmation of purity (≥85% by SDS-PAGE) and activity are essential quality control measures .

What are the most reliable methods for measuring GPAT2 enzymatic activity?

Measuring GPAT2 enzymatic activity requires specific considerations due to its substrate preferences and sensitivity to inhibitors. The following methods have proven reliable:

  • Radiometric assays: Measuring the incorporation of radiolabeled acyl-CoAs (particularly [1-¹⁴C]arachidonoyl-CoA) into lysophosphatidic acid. This approach should be performed with and without N-ethylmaleimide (NEM), as GPAT2 is NEM-sensitive while GPAT1 is NEM-resistant.

  • Coupled enzymatic assays: Following the production of LPA through coupled reactions that produce a spectrophotometrically detectable signal.

  • Mass spectrometry-based assays: Directly detecting and quantifying the LPA products formed, which allows for detailed analysis of acyl chain specificity.

Critical parameters for reliable GPAT2 activity measurements include:

  • Using appropriate substrates (arachidonoyl-CoA shows highest activity)

  • Optimizing reaction conditions (pH, temperature, cofactors)

  • Including proper controls (GPAT1-specific activity, total vs. NEM-sensitive activity)

  • Confirming mitochondrial localization and purity of enzyme preparations

  • Normalizing activity to protein expression levels .

How can researchers effectively study the physiological role of GPAT2 in testicular development and function?

Studying GPAT2's role in testicular development and function requires integrated approaches spanning molecular, cellular, and physiological techniques:

  • Developmental expression profiling: Analyzing Gpat2 mRNA and protein expression throughout testicular development. Data from rat sexual maturation studies show that testicular TAG content and arachidonic acid content in the TAG fraction peak at 30 days, coinciding with maximal Gpat2 expression.

  • Cell-specific localization: Using in situ hybridization and immunohistochemistry to precisely locate GPAT2 expression in testicular cell types. Research has shown that Gpat2 mRNA is expressed specifically in primary spermatocytes, with the protein detected in later stages of spermatogenesis.

  • Conditional knockout models: Generating tissue-specific and/or inducible Gpat2 knockout mice to study reproductive phenotypes without confounding effects from other tissues.

  • Lipidomic analysis: Comparing lipid profiles of wild-type and Gpat2-deficient testicular tissue at different developmental stages.

  • Functional fertility studies: Assessing sperm production, morphology, motility, and fertilization capacity in relation to GPAT2 expression.

  • Ex vivo tissue culture: Manipulating GPAT2 expression or activity in cultured testicular tissue or cells to observe acute effects on lipid metabolism and cellular function .

What analytical techniques are most informative for characterizing GPAT2-dependent changes in cellular lipid profiles?

Characterizing GPAT2-dependent lipid profile changes requires sophisticated analytical approaches:

  • Gas-liquid chromatography (GLC): Essential for determining fatty acid composition changes in different lipid fractions. This technique has revealed GPAT2's role in incorporating arachidonic acid into TAGs.

  • Liquid chromatography-mass spectrometry (LC-MS): Provides detailed analysis of various lipid species, including identification of specific acyl chain compositions in complex lipids. Studies using LC-MS have identified specific DHA-containing glycerolipids produced through GPAT2/PLAT2 activity.

  • Thin-layer chromatography (TLC): Useful for separating and quantifying major lipid classes (TAG, phospholipids, etc.) following metabolic labeling with radioactive fatty acids.

  • Lipidomic approaches: Comprehensive mass spectrometry-based methods for global lipid profiling, revealing both expected and unexpected changes in lipid composition.

  • Metabolic flux analysis: Using stable isotope-labeled precursors to track the metabolic fate of specific fatty acids through GPAT2-dependent pathways.

When analyzing GPAT2-dependent changes, researchers should focus on:

  • Comparing acyl chain compositions across lipid classes

  • Quantifying specific lipid species like LPA 22:6, DG 44:12, TG 66:18, and PC 44:12

  • Analyzing changes in both neutral lipids and membrane phospholipids

  • Correlating lipid changes with functional cellular properties .

What are common challenges in expressing active recombinant GPAT2 and how can they be addressed?

Researchers frequently encounter several challenges when expressing recombinant GPAT2:

  • Protein misfolding: As a mitochondrial membrane protein, GPAT2 may misfold in heterologous expression systems.

    • Solution: Optimize expression conditions (temperature, induction time), use chaperone co-expression systems, or employ eukaryotic expression hosts that better support proper folding.

  • Low enzymatic activity: Recombinant GPAT2 often shows modest activity increases (typically ~30% over baseline).

    • Solution: Ensure proper subcellular targeting by verifying mitochondrial localization; optimize assay conditions using preferred substrates like arachidonoyl-CoA; consider using detergents that maintain native conformation.

  • Interference from endogenous GPAT activities: Host cells have background GPAT activity that can mask recombinant GPAT2 activity.

    • Solution: Use NEM sensitivity to differentiate GPAT2 activity; consider GPAT1-knockout cell lines as expression hosts; validate with multiple activity assays.

  • Variable protein size: Studies have reported both 89 kDa and 80 kDa forms of GPAT2.

    • Solution: Use multiple antibody detection methods; perform in vitro translation to confirm expected size; consider potential post-translational processing events .

How should researchers interpret seemingly contradictory data on GPAT2 substrate specificity?

When facing contradictory data regarding GPAT2 substrate specificity, consider these analytical frameworks:

  • Experimental context differences: In vitro versus in vivo experiments may yield different results due to the cellular environment's influence on enzyme activity. For example, GPAT2 shows preference for arachidonoyl-CoA in CHO-K1 cells, while studies with oleate in Cos-7 cells also show incorporation into TAG.

  • Expression level effects: Extremely high overexpression may alter substrate preferences due to forced utilization of non-preferred substrates.

    • Analytical approach: Perform dose-response experiments with varying expression levels to determine if substrate preference changes with expression level.

  • Species and isoform differences: GPAT2 from different species (mouse, human, yeast) may have different substrate preferences despite sequence homology.

    • Analytical approach: Direct comparative studies of orthologs under identical conditions to determine true functional differences.

  • Assay methodology variations: Different activity assay formats may bias toward detection of certain substrates.

    • Analytical approach: Use multiple independent methods to confirm substrate preference, combining in vitro biochemical assays with cellular metabolic labeling and lipidomic analyses .

What controls are essential for accurately interpreting GPAT2 functional studies?

Rigorous controls are critical for meaningful interpretation of GPAT2 functional studies:

  • Expression controls:

    • Empty vector transfection to account for transfection effects

    • Western blotting to confirm GPAT2 protein expression

    • Subcellular fractionation to verify mitochondrial localization

  • Activity controls:

    • NEM treatment to distinguish from GPAT1 activity (GPAT2 is NEM-sensitive)

    • Temperature-inactivated enzyme preparations

    • Known GPAT inhibitors to confirm specificity of measured activity

  • Substrate controls:

    • Multiple fatty acyl-CoA substrates tested under identical conditions

    • Concentration-dependent responses to rule out non-specific effects

    • Non-radioactive carrier control when using trace radioactive substrates

  • Cellular controls:

    • GPAT2 knockout/knockdown cells to establish baseline

    • Rescue experiments to confirm phenotype specificity

    • Time-course studies to distinguish direct from secondary effects

  • Physiological relevance controls:

    • Correlation of expression with physiological changes (e.g., testicular development)

    • Comparison of experimental expression levels with physiological levels

    • Multiple cell/tissue types to confirm tissue-specific functions .

What emerging technologies could advance our understanding of GPAT2 function and regulation?

Several cutting-edge technologies hold promise for deepening our understanding of GPAT2:

  • CRISPR-Cas9 genome editing: Creating precise mutations or regulatory element modifications in endogenous GPAT2 to study function in relevant physiological contexts without overexpression artifacts.

  • Single-cell transcriptomics and proteomics: Mapping GPAT2 expression patterns with unprecedented resolution to identify specific cell populations where GPAT2 functions during development or disease.

  • Proximity labeling proteomics (BioID, APEX): Identifying GPAT2 protein interaction networks in living cells by tagging proteins in proximity to GPAT2, revealing potential regulatory partners.

  • Cryo-electron microscopy: Determining the structure of GPAT2 alone or in complexes with substrates or other proteins to understand the molecular basis of substrate specificity.

  • Organoid models: Studying GPAT2 function in complex 3D tissue models that better recapitulate testicular development and function than traditional cell cultures.

  • Lipid imaging techniques: Employing novel microscopy approaches with specific lipid probes to visualize GPAT2-dependent lipid dynamics in living cells with spatial and temporal resolution .

What are the critical unanswered questions regarding GPAT2's role in normal physiology and disease states?

Despite significant advances, several fundamental questions about GPAT2 remain unanswered:

  • Physiological regulation: How is GPAT2 expression and activity regulated during development and in response to hormonal or metabolic signals? Unlike GPAT1, GPAT2 does not respond to nutritional status, suggesting unique regulatory mechanisms.

  • Substrate selection mechanism: What structural features of GPAT2 determine its preference for polyunsaturated fatty acids like arachidonic acid, and how does this differ from other GPAT isoforms?

  • Cancer involvement: What mechanisms link GPAT2 overexpression to cancer development? Does GPAT2's role in altering membrane properties directly contribute to tumorigenic processes, or are specific signaling lipids involved?

  • Reproductive function: What specific aspects of spermatogenesis require GPAT2 activity? Are GPAT2-derived lipids structural components of sperm membranes, signaling molecules, or energy sources?

  • Therapeutic potential: Could targeting GPAT2 provide new approaches for treating GPAT2-overexpressing cancers without affecting normal tissues, given its restricted physiological expression pattern?

  • Evolutionary conservation: Why has GPAT2 evolved to be so divergent from GPAT1 (only 27% amino acid identity) despite both being mitochondrial isoforms, and what selective pressures drove this divergence? .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.