Recombinant Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant glycerol-3-phosphate acyltransferase (PlsY) is a bacterial enzyme integral to membrane phospholipid biosynthesis. It catalyzes the transfer of an acyl group from acylphosphate to glycerol-3-phosphate (G3P), forming lysophosphatidic acid (LPA), the first step in phosphatidic acid synthesis . Unlike eukaryotic GPATs, PlsY operates in tandem with PlsX, which converts acyl-acyl carrier protein (acyl-ACP) to acylphosphate . This enzyme is critical for bacterial membrane biogenesis and has been structurally and functionally characterized in Streptococcus pneumoniae .

Table 1: Functional Domains of PlsY

DomainKey Residues/FeaturesRole
Motif 1Ser, ArgCatalytic activity
Motif 2Gly-rich phosphate-binding loopG3P substrate binding
Motif 3His, Asn, GluStructural integrity & catalysis

Catalytic Mechanism

PlsY exhibits unique substrate specificity and reaction dynamics:

  • Substrates: Utilizes acylphosphate (generated by PlsX) and G3P .

  • Reaction: Transfers an acyl group to the sn-1 position of G3P, producing LPA .

  • Kinetics: Mutagenesis of glycine residues in Motif 2 increases Km for G3P, confirming its role in substrate binding .

Inhibition and Regulation

PlsY is noncompetitively inhibited by palmitoyl-CoA, a long-chain acyl-CoA derivative . This regulation suggests feedback control to balance fatty acid availability and membrane lipid synthesis.

Table 2: Site-Directed Mutagenesis Insights

MutationEffect on ActivityFunctional Implication
Gly → Ala (Motif 2)↑ Km for G3PMotif 2 stabilizes G3P binding
His/Asn → Ala (Motif 3)↓ Catalytic activityCritical for catalysis
Glu → Ala (Motif 3)Structural destabilizationMaintains enzyme conformation
  • Structural studies: Substituted cysteine accessibility method confirmed extracellular orientation of the N-terminus and identified membrane-spanning helices .

  • Evolutionary distinction: PlsY lacks homology with eukaryotic GPATs but shares functional parallels with PlsC-family acyltransferases .

Comparative Analysis with Eukaryotic GPATs

FeaturePlsY (Bacterial)Eukaryotic GPATs (e.g., GPAT9)
Subcellular localizationMembrane-boundER or mitochondrial membranes
SubstrateAcylphosphateAcyl-CoA/ACP
Regiospecificitysn-1 acylationsn-1 (membrane lipids) or sn-2 (cutin/suberin)
Phosphatase activityAbsentPresent in some plant GPATs

Applications and Implications

  • Antimicrobial targets: PlsY’s essential role in bacterial membrane synthesis makes it a candidate for novel antibiotics .

  • Biotechnological potential: Engineered PlsY variants could optimize lipid biosynthesis in industrial microbes.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; VV1_0626; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Vibrio vulnificus (strain CMCP6)
Target Names
plsY
Target Protein Sequence
MDAMAVTMTIIAYLLGSISSAVLICRVLRLPDPRGVGSNNPGATNVLRIGGKGAAAAVLL CDMLKGTIPVWSGYYLGIEPVLLGVIAIAACLGHMYPLFFHFQGGKGVATALGAIAPIGL DLTGMIMATWLLVAILFRYSSLAALVTVLLAPMYTWMIKPQYTLPVGMLCCLIVLRHHQN IRRLFTGEEPKIGEKKLQMPKSQ
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links

KEGG: vvu:VV1_0626

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Glycerol-3-phosphate acyltransferase and what is its primary function?

Glycerol-3-phosphate acyltransferase (GPAT) catalyzes the initial step of glycerolipid synthesis, which is the incorporation of an acyl group from acyl-CoA onto glycerol-3-phosphate (G3P). This reaction represents the rate-limiting enzyme for the de novo pathway of glycerophospholipid synthesis due to having the lowest specific activity in the pathway . The primary product of this enzymatic reaction is typically lysophosphatidic acid (LPA), which is subsequently converted to phosphatidic acid (PA) by 1-acyl glycerol-3-phosphate acyltransferase (AGPAT) . The GPAT-catalyzed reaction is fundamental to the synthesis of both membrane phospholipids and storage triglycerides, playing crucial roles in cellular metabolism, membrane structure, and energy storage.

How are GPATs classified and what distinguishes different isoforms?

In mammals, four isoforms of GPATs have been identified based on three key characteristics:

  • Subcellular localization

  • Substrate preferences

  • N-ethylmaleimide (NEM) sensitivity

These isoforms are classified into two main groups:

  • Mitochondrial GPATs: GPAT1 and GPAT2, which are localized in the outer mitochondrial membrane

  • Endoplasmic reticulum GPATs: GPAT3 and GPAT4, which are localized in the ER membrane

In plants, GPATs exhibit unique characteristics not found in animals or microorganisms. For example, Arabidopsis GPAT4 and GPAT6 predominantly acylate the sn-2 position of glycerol-3-phosphate and possess an additional phosphatase domain, resulting in the production of sn-2 monoacylglycerol (2-MAG) rather than LPA . GPAT5 also shows preference for sn-2 acylation but lacks phosphatase activity, thus producing 2-acyl-LPA . These plant-specific enzymes are essential for the biosynthesis of extracellular lipid polymers like cutin and suberin.

What experimental systems are commonly used to study recombinant GPATs?

Several experimental systems have been documented for studying recombinant GPATs:

  • Adenoviral expression systems: These allow for efficient expression of recombinant GPATs in mammalian cells. For instance, human AGPAT10/GPAT3 has been expressed using the AdEasy adenoviral system with V5 epitope tagging for detection and purification .

  • Stable cell lines: Chinese Hamster Ovary (CHO) cells stably expressing AGPAT10/GPAT3-EGFP fusions have been used to study subcellular localization and functional properties .

  • Heterologous expression in HEK-293 cells: These cells are commonly infected with recombinant GPAT-adenovirus for enzyme activity assays and biochemical characterization .

  • Plant expression systems: For plant GPATs, Arabidopsis mutants and transgenic plants have been utilized to characterize the unique biochemical properties of plant GPATs .

How does the positional specificity of acylation by different GPAT isoforms affect product formation and biological function?

The positional specificity of acylation (sn-1 versus sn-2) is a critical determinant of GPAT function and product formation:

sn-1 Acylation (Classical pathway):

  • Typical of most characterized eukaryotic membrane-bound GPATs

  • Produces 1-acyl-LPA as the primary product

  • Leads to conventional membrane phospholipid and triacylglycerol synthesis

sn-2 Acylation (Plant-specific pathway):

  • Distinctive of plant GPATs involved in extracellular lipid polymer synthesis

  • GPAT4 and GPAT6 acylate predominantly at the sn-2 position

  • Combined with phosphatase activity, these enzymes produce sn-2 monoacylglycerol (2-MAG)

  • GPAT5 also prefers sn-2 acylation but lacks phosphatase activity, yielding 2-acyl-LPA

This positional specificity has profound implications for biological function. The sn-2 acylation preference and phosphatase activity in plant GPATs appear to be specialized adaptations for synthesizing extracellular glycerolipid polymers such as cutin and suberin. These polymers are crucial for plant adaptation to terrestrial environments, providing barriers against pathogens, stress resistance, and maintaining organ identity . The unique catalytic properties of these plant GPATs represent a clear divergence from the classical glycerolipid synthesis pathway and highlight how enzymatic modifications can lead to specialized biological functions.

What strategies are effective for expressing and purifying active recombinant GPAT enzymes?

Expressing and purifying active recombinant GPAT enzymes presents several challenges due to their membrane-associated nature. Based on successful approaches in the literature, the following strategies are recommended:

Expression System Selection:

  • Adenoviral expression systems: The AdEasy adenoviral system has been successfully used for human AGPAT10/GPAT3 expression, with specific protocols involving:

    • Cloning the GPAT coding sequence into a pShuttle-CMV vector

    • Adding epitope tags (e.g., V5) for detection and purification

    • Generating recombinant adenovirus through homologous recombination with pAdEasy-1

Purification Approaches:

  • Epitope tagging: Adding epitope tags such as V5 facilitates immunoaffinity purification while minimizing interference with enzyme activity

  • Subcellular fractionation: Isolating the appropriate membrane fraction (mitochondrial outer membrane or ER) as an initial purification step

  • Detergent solubilization: Careful selection of detergents that maintain enzyme activity while solubilizing the protein from membranes

Verification of Activity:
Activity assays typically involve measuring the incorporation of radiolabeled substrates:

  • Using [14C]-glycerol-3-phosphate as a substrate to track acylation

  • Optimizing reaction conditions including acyl-CoA concentration (typically 60 μM) and G3P concentration (150-80 μM)

What methods are most effective for determining subcellular localization of GPAT isoforms?

Determining the subcellular localization of GPAT isoforms is crucial for understanding their functional roles. The following approaches have proven effective:

Fluorescent Protein Fusion Constructs:

  • GPAT-EGFP fusion proteins have been successfully used to visualize subcellular localization in live cells

  • Stable expression in cell lines such as CHO cells provides consistent results

Immunofluorescence Microscopy:
A detailed protocol based on published methods includes:

  • Growing cells on glass coverslips

  • Fixation with cold methanol (-20°C) for 20 minutes

  • Permeabilization with 0.1% Triton X-100 for 25 minutes

  • Blocking with appropriate blocking buffer

  • Primary antibody incubation (e.g., with organelle markers like Sec61-β for ER) for 60 minutes at 37°C

  • Washing with PBS (3×5 minutes)

  • Secondary antibody (e.g., AlexaFluor 598-coupled) incubation for 60 minutes at 37°C

  • Counterstaining with DAPI for nuclear visualization

  • Mounting on glass slides with appropriate mounting medium (e.g., Aqua Poly/Mount)

Co-localization Studies:

  • Using established organelle markers: Sec61-β for ER, mitochondrial markers for mitochondrial GPATs

  • Quantitative co-localization analysis with appropriate software

How can researchers accurately measure GPAT enzyme activity and specificity?

Accurate measurement of GPAT enzyme activity requires careful attention to reaction conditions and analysis methods:

Standard In Vitro Assay Protocol:

  • Prepare cell lysates or membrane fractions from cells expressing the recombinant GPAT

  • Assemble reaction mixture containing:

    • 60 μM acyl-CoA

    • 150-80 μM glycerol-3-phosphate

    • Radiolabeled substrate ([14C]-glycerol-3-phosphate) for tracking

    • Appropriate buffer conditions (pH, salt concentration)

  • Incubate for defined time periods

  • Extract and separate lipid products using thin-layer chromatography

  • Quantify incorporation of radiolabel into products

Determining Positional Specificity:
To determine whether acylation occurs at the sn-1 or sn-2 position:

  • Isolate reaction products

  • Subject to phospholipase A1 or A2 digestion

  • Analyze released fatty acids and remaining lysophospholipids

  • Compare with standards of known positional isomers

Substrate Preference Analysis:
To determine acyl-CoA preference:

  • Conduct parallel assays with different acyl-CoA species (varying chain length and saturation)

  • Maintain constant concentration of glycerol-3-phosphate

  • Measure relative rates of product formation

  • Analyze kinetic parameters (Km, Vmax) for different substrates

What are the optimal conditions for expressing recombinant GPAT using adenoviral vectors?

Based on published protocols, the following conditions are recommended for optimal recombinant GPAT expression using adenoviral vectors:

Vector Construction:

  • Clone the full-length GPAT coding sequence into pShuttle-CMV vector

  • Add appropriate epitope tags (e.g., V5) at the N-terminus to avoid interfering with membrane insertion

  • Verify sequence integrity and correct orientation through restriction digestion and sequencing

Adenovirus Production:

  • Linearize the pShuttle-CMV-GPAT construct with PmeI

  • Co-transform with pAdEasy-1 (digested with PacI) into E. coli strain BJ5183 for homologous recombination

  • Select recombinants and verify by restriction analysis

  • Transfect HEK-293 cells to produce recombinant virus

  • Harvest virus after cytopathic effect is observed

  • Determine viral titer through standard methods

Infection Parameters:

  • Optimal multiplicity of infection (MOI): 150 for HEK-293 cells

  • Infection duration: 24-48 hours for maximal protein expression

  • Culture medium: DMEM with 10% FBS is typically sufficient

Expression Verification:

  • Western blotting using anti-V5 antibodies to detect tagged protein

  • Enzyme activity assays to confirm functional expression

  • Immunofluorescence to verify subcellular localization

How can researchers troubleshoot low activity of recombinant GPAT enzymes?

When facing challenges with low activity of recombinant GPAT enzymes, consider the following troubleshooting approaches:

Protein Expression Issues:

  • Verify protein expression levels by Western blot

  • Check for protein degradation

  • Ensure proper subcellular targeting by microscopy or fractionation

  • Try alternative epitope tags if interference is suspected

Enzyme Activity Conditions:

  • Optimize reaction buffer components:

    • Test pH range (typically 7.0-8.0)

    • Adjust Mg2+ concentration (1-10 mM)

    • Evaluate need for reducing agents (DTT or β-mercaptoethanol)

  • Substrate considerations:

    • Verify substrate quality (acyl-CoA stability)

    • Optimize substrate concentrations (60 μM acyl-CoA, 150-80 μM G3P typically effective)

    • Test different acyl-CoA species if substrate specificity is narrow

  • Membrane environment:

    • Add phospholipids to reaction mixture to provide suitable hydrophobic environment

    • Try mild detergents to improve substrate accessibility

Technical Assay Issues:

  • Increase sensitivity using higher specific activity radiolabeled substrates

  • Extend reaction time if activity is low

  • Reduce background by optimizing washing steps

  • Consider alternative detection methods (LC-MS/MS analysis of products)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.