Recombinant Glycine max Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Glycine max (Soybean) (Glycine hispida)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQVKQV LANGKKGALNVGAVLILPEGFELAPPDRISPEIKEKIGNLSFQNYRPTKKNILVVGPVPG QKYKEITFPILSPDPTTKRDVHFLKYPIYVGGNRGRGQIYLDGSKSNNNVYNATAAGMVK KIIRKEKGGYEITIVDALDGREVIDIIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFFASIILAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f and how does it differ from holocytochrome f in Glycine max?

Apocytochrome f is the protein component of cytochrome f prior to heme attachment in soybean (Glycine max). This precursor form lacks the covalently bound heme group that characterizes the functional holocytochrome f. In research contexts, the distinction is crucial as the apocytochrome represents the initial translation product of the petA gene before post-translational modification. The conversion from apo- to holocytochrome f requires specific thiol reduction pathways and enzymatic mechanisms within the thylakoid membrane system. This maturation process involves transmembrane thioreduction pathways that deliver reducing equivalents to the apocytochrome prior to its conversion to the holoform . Researchers investigating photosynthetic electron transport must consider this distinction when interpreting experimental results, as only the holo-form participates effectively in electron transfer.

How does recombinant Glycine max Apocytochrome f compare to native forms in terms of structure and function?

ParameterNative Apocytochrome fRecombinant Apocytochrome f
Post-translational modificationsContains plant-specific modificationsMay lack some modifications depending on expression system
Folding characteristicsNatural folding in chloroplast environmentFolding depends on expression system conditions
PurityMixed with other chloroplast proteinsHigher purity (typically >95%)
TagsNo artificial tagsMay contain affinity tags based on production process
Storage stabilityLimited outside natural environmentEnhanced with stabilizing buffers (Tris-based, 50% glycerol)

These differences necessitate verification steps when using recombinant proteins for structural studies or when reconstituting functional complexes in vitro.

What are the optimal conditions for handling and storing recombinant Glycine max Apocytochrome f?

Maintaining protein integrity is crucial for experimental reproducibility. Based on empirical studies, the following storage protocol is recommended:

Primary storage should be at -20°C, with extended storage at -20°C or -80°C in a Tris-based buffer containing 50% glycerol optimized specifically for this protein . This high glycerol content prevents ice crystal formation that can denature the protein structure.

For working solutions, prepare small aliquots to avoid repeated freeze-thaw cycles, which significantly compromise protein integrity. Working aliquots can be maintained at 4°C for up to one week . For experimental protocols requiring room temperature handling, limit exposure time to minimize protein degradation.

When designing experiments involving temperature shifts or buffer exchanges, researchers should include appropriate controls to account for potential changes in protein conformation or activity. Quantitative assays of protein integrity following storage are advisable, particularly for experiments sensitive to protein conformational changes.

What expression systems are most effective for producing functional recombinant Glycine max Apocytochrome f for research applications?

The selection of expression systems for recombinant Glycine max Apocytochrome f production requires balancing yield, proper folding, and functional relevance. Based on comparative studies, several systems demonstrate distinctive advantages:

  • Bacterial expression systems (E. coli): Provide high yield but may lack appropriate mechanisms for disulfide bond formation needed for proper folding. Additional considerations include codon optimization for the petA gene and the potential need for chaperone co-expression to facilitate correct folding.

  • Plant-based expression systems: Offer more authentic post-translational modifications but typically with lower yield. Transgenic expression in Arabidopsis thaliana has been successfully demonstrated for other soybean proteins , suggesting a viable approach for Apocytochrome f.

  • Cell-free systems: Allow controlled redox environments crucial for proper formation of the protein's disulfide bonds, though scaling challenges exist.

For functional studies, researchers should validate the recombinant protein's conformation using circular dichroism spectroscopy and assess its ability to incorporate heme when exposed to appropriate enzymes and cofactors, as the protein's biological activity depends on successful conversion to the holocytochrome form .

How can researchers effectively design import experiments to study the chloroplast targeting and processing of Apocytochrome f?

Chloroplast import experiments for Apocytochrome f require careful experimental design to track the protein's targeting, processing, and assembly. Based on established methodologies, a systematic approach includes:

  • Construct preparation: Engineer fusion proteins containing the N-terminal targeting sequence of Apocytochrome f linked to reporter proteins such as DHFR (dihydrofolate reductase). This approach has been validated for similar chloroplast proteins .

  • In vitro translation: Generate radiolabeled proteins using wheat germ extract systems to enable sensitive detection.

  • Isolation of intact chloroplasts: Typically from pea seedlings, ensuring the organelles remain structurally and functionally intact.

  • Import reactions: Conduct import reactions under illuminated conditions for approximately 20 minutes, as light provides the energy required for import processes .

  • Thermolysin treatment: Apply post-import protease treatment to distinguish between proteins that are fully imported versus those merely associated with the chloroplast surface.

  • Fractionation and analysis: Separate thylakoid and stromal fractions to determine the sub-organellar localization of imported proteins.

Researchers should include appropriate controls, such as known chloroplast-targeted proteins (e.g., plastocyanin targeting sequence fused to DHFR), to validate the import system . This methodological approach allows for quantitative assessment of import efficiency and processing patterns specific to Apocytochrome f.

How does the expression of petA gene in Glycine max respond to environmental stressors compared to other photosynthetic components?

The petA gene expression in Glycine max shows distinctive response patterns to environmental stressors that differ from other photosynthetic genes. Understanding these responses is crucial for interpreting experimental results in stress biology research:

Environmental StressorpetA Expression ResponseComparison to Other Photosynthetic Genes
Sulfate deficiencyModerately affectedLess sensitive than β-conglycinin expression
Light stressShows diurnal regulationSimilar pattern to other photosynthetic genes
Temperature variationResponds to accumulated temperatureCorrelates with flowering time genetics
Hormonal influence (ABA)Expression modulation observedShared mechanism with some storage proteins

When designing experiments to study environmental effects on photosynthetic machinery, researchers should account for these differential responses. For example, experimental protocols investigating sulfate deficiency should include measurements of both petA expression and the accumulation of assembled cytochrome b6f complex to distinguish between transcriptional and post-translational effects .

What methodological approaches can effectively assess the role of Apocytochrome f in cytochrome b6f complex assembly?

Investigating the role of Apocytochrome f in cytochrome b6f complex assembly requires multi-layered analytical approaches:

  • Genetic manipulation strategies: Utilize CRISPR-Cas9 editing to introduce specific mutations in the petA gene or regulatory elements. Alternative approaches include RNA interference targeting petA transcript or antisense oligonucleotides for temporary suppression.

  • Protein accumulation analysis: Implement immunoblotting with antibodies specific to different subunits of the cytochrome b6f complex (Rieske FeS, cytochrome b6, subunit IV) to quantify assembly effects .

  • Heme incorporation assays: Apply heme staining techniques to distinguish between apo- and holocytochrome f, providing insight into the maturation process critical for complex assembly .

  • Complex activity measurements: Measure electron transport rates through the cytochrome b6f complex using artificial electron donors and acceptors to correlate structural assembly with functional capacity.

  • Microscopy approaches: Utilize confocal microscopy with fluorescently tagged components to visualize assembly intermediates and their subcellular localization.

What experimental approaches can determine the interaction between CCDA and Apocytochrome f in the thylakoid membrane?

The elucidation of protein-protein interactions between CCDA and Apocytochrome f within the thylakoid membrane requires specialized techniques addressing the challenges of membrane protein analysis:

  • Split-protein complementation assays: Engineer fusion constructs with complementary fragments of reporter proteins (such as split GFP or luciferase) attached to CCDA and Apocytochrome f to visualize interactions in vivo.

  • Co-immunoprecipitation with membrane solubilization: Develop protocols using mild detergents that maintain membrane protein interactions while allowing effective precipitation of protein complexes.

  • Förster resonance energy transfer (FRET): Apply FRET microscopy using appropriate fluorophore pairs to detect proximity between CCDA and Apocytochrome f within the membrane environment.

  • Crosslinking coupled with mass spectrometry: Implement chemical crosslinking to capture transient interactions, followed by mass spectrometric analysis to identify interaction interfaces.

  • Topological mapping: Utilize PhoA/LacZ sandwich fusion constructs similar to those used for CCDA topology determination to identify which domains of Apocytochrome f are accessible for interaction with CCDA.

Research evidence suggests that CCDA functions in a thylakoid transmembrane thioreduction pathway critical for delivering reducing equivalents to Apocytochrome f prior to heme attachment . When designing interaction studies, researchers should consider the redox state of the system, as the conserved cysteine residues in both proteins likely play crucial roles in their functional interaction.

How can researchers distinguish between direct effects on Apocytochrome f synthesis versus defects in holocytochrome f maturation?

Differentiating between defects in Apocytochrome f synthesis and its maturation to holocytochrome f presents a significant methodological challenge. A systematic experimental approach includes:

  • Transcript analysis: Implement quantitative RT-PCR to measure petA transcript levels, determining if observed protein deficiencies originate at the transcriptional level .

  • Pulse-chase experiments: Apply radioactive amino acid labeling to track newly synthesized Apocytochrome f and monitor its conversion to holocytochrome f over time.

  • Fractionation studies: Separate membrane and soluble fractions to detect potentially accumulating Apocytochrome f that fails to integrate properly into the thylakoid membrane.

  • Protease protection assays: Use differential protease sensitivity to determine if Apocytochrome f assumes the correct topology within the membrane.

  • Heme availability assessment: Supplement experimental systems with exogenous heme precursors to determine if maturation defects stem from cofactor limitations.

Research findings demonstrate that mutations in the CCDA gene can dramatically reduce holocytochrome f levels without affecting petA gene expression . This observation underscores the importance of methodological approaches that can distinguish between synthesis and maturation defects. Experiments should include appropriate controls, such as verified thylakoid membrane proteins with similar topology but different maturation requirements.

What are the methodological challenges in studying the dynamic redox states of Apocytochrome f during its maturation process?

Investigating the dynamic redox changes during Apocytochrome f maturation presents unique methodological challenges that require specialized approaches:

  • Thiol-trapping techniques: Apply alkylating agents (such as N-ethylmaleimide or iodoacetamide) at different stages of maturation to capture specific redox states of cysteine residues.

  • Redox proteomics approaches: Implement differential labeling of reduced versus oxidized thiols followed by mass spectrometry to quantify the redox state of specific cysteine residues.

  • Real-time redox sensing: Develop fusion constructs with redox-sensitive fluorescent proteins (such as roGFP) to monitor redox changes in vivo.

  • Reconstitution systems: Establish in vitro systems with defined redox components to systematically test the requirements for Apocytochrome f reduction prior to heme attachment.

  • Site-directed mutagenesis: Create cysteine variants to identify which specific residues participate in redox reactions versus structural disulfides.

The research evidence suggests that a transmembrane thioreduction pathway involving CCDA is essential for providing reducing equivalents to Apocytochrome f prior to heme attachment . Methodologically, researchers must account for the compartmentalization of redox processes across the thylakoid membrane and the potential for rapid oxidation of reduced intermediates during experimental manipulation.

How does the phylogenetic conservation of Apocytochrome f structure across plant species inform experimental design for functional studies?

The evolutionary conservation patterns of Apocytochrome f provide critical insights for experimental design in functional studies:

Plant GroupConservation LevelExperimental Design Implications
Angiosperms (including Glycine max)High sequence conservation in functional domainsAllows for cross-species complementation studies
GymnospermsModerate divergenceMay require species-specific antibodies for detection
Bryophytes and LycophytesGreater sequence divergenceImportant for evolutionary studies of function
Algae (green and red)Varies by clade; red algal plastid genomes retain the gene Valuable for comparative genomic approaches

When designing experiments based on phylogenetic information, researchers should:

  • Identify highly conserved regions as targets for antibody generation or RNA interference to maximize specificity and effectiveness.

  • Utilize cross-species complementation approaches to test functional conservation, particularly when working with difficult experimental systems.

  • Apply comparative biochemical analyses to determine if sequence divergence in specific regions correlates with functional adaptations.

  • Consider co-evolutionary relationships with interaction partners, as systems like CCDA and Apocytochrome f likely evolved coordinately to maintain functional interactions.

The conservation of the petA gene in the less derived red algal plastid genome of Porphyra purpurea provides an evolutionary anchor point that can inform experimental approaches investigating the fundamental aspects of cytochrome f function conserved across photosynthetic organisms.

What high-throughput methods can accelerate research on Apocytochrome f and its role in photosynthetic efficiency?

Advancing research on Apocytochrome f can benefit significantly from emerging high-throughput technologies:

  • CRISPR library screening: Develop pooled CRISPR screens targeting genes involved in cytochrome f maturation and function, using photosynthetic efficiency as a readout.

  • Single-cell proteomics: Apply emerging single-cell proteomic techniques to understand cell-to-cell variation in cytochrome f maturation and assembly.

  • Automated chloroplast isolation and analysis: Implement robotic platforms for standardized chloroplast isolation and activity measurements to increase throughput and reproducibility.

  • AI-driven protein structure prediction: Utilize advanced computational tools like AlphaFold to predict the structural consequences of mutations or post-translational modifications in Apocytochrome f.

  • Genome-wide association studies: Apply GWAS approaches similar to those used for flowering time to identify genetic variants affecting photosynthetic efficiency through cytochrome f-related mechanisms.

Each of these approaches presents specific methodological considerations. For example, CRISPR screens require careful design of guide RNA libraries targeting conserved regions of genes in the cytochrome f maturation pathway, while GWAS studies need sufficient genetic diversity in the soybean populations analyzed. Researchers should also consider integrative approaches that combine multiple high-throughput methods to provide complementary insights.

How can researchers effectively integrate temperature adaptation studies of photosynthetic proteins with broader phenotypic analyses?

Integration of temperature response studies on photosynthetic proteins like Apocytochrome f with broader phenotypic analyses requires methodological approaches that span multiple biological scales:

  • Active accumulated temperature (AAT) measurements: Calculate AAT using the formula:

    AAT=i=1n(TiB)AAT = \sum_{i=1}^{n} (T_i - B)

    where T<sub>i</sub> is the average temperature for the i<sup>th</sup> day, and B is the base temperature for soybean growth (typically 10°C) .

  • Correlation analyses: Implement statistical methods to identify associations between AAT responses and molecular parameters like cytochrome f accumulation or activity.

  • Multi-environment trials: Design experiments across temperature gradients or controlled environment chambers to capture genotype-by-environment interactions affecting photosynthetic proteins.

  • Phenomics approaches: Utilize high-throughput phenotyping platforms to simultaneously measure multiple physiological parameters related to photosynthetic efficiency.

  • Predictive modeling: Develop models incorporating molecular data on temperature sensitivity of proteins like Apocytochrome f to predict whole-plant responses to changing climatic conditions.

Research findings indicate that soybean cultivars exhibit significant variation in their response to temperature accumulation , suggesting potential differences in the temperature sensitivity of photosynthetic machinery that could be exploited for crop improvement. Methodologically, researchers should ensure appropriate statistical designs to distinguish between direct temperature effects on protein function versus developmental responses to temperature cues.

What considerations are important when designing gene editing experiments targeting the petA gene or its regulatory elements?

Designing effective gene editing experiments for the petA gene requires careful consideration of its genomic context and expression regulation:

  • Chloroplast genome targeting challenges: Since petA is typically encoded in the chloroplast genome, researchers must address the unique challenges of chloroplast transformation rather than standard nuclear genome editing techniques.

  • Copy number considerations: Account for the polyploid nature of the chloroplast genome, which necessitates strategies for achieving homoplasmy (uniform editing of all genome copies).

  • Editing strategy selection: Choose between various approaches:

    • Site-directed mutagenesis for specific amino acid changes

    • Promoter modifications to alter expression levels

    • Introduction of reporter fusions for visualization

  • Phenotypic rescue planning: Develop complementation strategies to verify that observed phenotypes result specifically from petA modifications rather than off-target effects.

  • Selection marker considerations: Design selection systems compatible with chloroplast biology, such as spectinomycin resistance for primary transformant selection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.