Recombinant Glycine max ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Functional Role in ATP Synthase Assembly and Stability

The ATP synthase complex in chloroplasts comprises two modules: the catalytic CF₁ (α₃β₃γδε) and the proton-channeling CF₀ (ab₂c₁₀–₁₄) . Subunit a (atpI) interacts with the Atp9 ring (c-subunit oligomer) and facilitates proton translocation . Studies in alkaliphilic Bacillus pseudofirmus homologs reveal that AtpI stabilizes the rotor (c-ring) and enhances membrane attachment of the CF₁ domain . Deletion of atpI reduces ATP synthase activity by 34% and increases cytoplasmic CF₁ levels, indicating its role in structural integrity .

Role in Proton Channeling

Subunit a (atpI) collaborates with the Atp9 ring to convert proton motive force into mechanical rotation, driving ATP synthesis . In Bacillus pseudofirmus, AtpI deletion destabilizes the rotor and reduces ATPase activity by 30–40% .

Comparative Analysis with Other ATP Synthase Subunits

SubunitGeneSubunit NameLocalizationHost Systems
atpIatpICF₀ A subunitChloroplast membraneE. coli, yeast, mammalian cells
atpBatpBCF₁ beta subunitChloroplast stromaE. coli, yeast
atpAatpACF₁ alpha subunitChloroplast stromaE. coli, yeast

Implications for Biotechnological Applications

Recombinant atpI enables mechanistic studies of ATP synthase assembly and proton translocation. Its production in heterologous systems supports structural biology efforts, such as cryo-EM analyses of CF₀-CF₁ interactions . Additionally, insights from atpI-deficient mutants highlight its potential as a target for engineering stress-tolerant crops with optimized photosynthetic efficiency .

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we can accommodate specific format requests. Please indicate your desired format when placing your order, and we will fulfill your requirements to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributor.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please inform us, and we will prioritize the development of your specified tag.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Glycine max (Soybean) (Glycine hispida)
Target Names
atpI
Target Protein Sequence
MNVLLCSINTLKRLYDISAVEVGQHFYWQIGSFQVHAQVLITSWVVIALLLVSAILIIRN LQTIPAFGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTLFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSIAYFYAGLSKKGLAYFNKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the role of ATP synthase subunit a (atpI) in chloroplastic energy metabolism?

The chloroplastic ATP synthase subunit a (atpI) is a critical membrane-embedded component of the F0 portion of the ATP synthase complex. It functions as part of the proton channel that facilitates H+ translocation across the thylakoid membrane, converting the proton motive force (pmf) into mechanical energy that drives ATP synthesis. The atpI subunit contains essential residues that form part of the proton pathway, allowing protons to flow down their concentration gradient from the thylakoid lumen to the stroma. This proton flow drives the rotation of the c-ring within the membrane, which is mechanically coupled to conformational changes in the F1 portion that catalyze ATP synthesis.

In soybean (Glycine max) and other plants, this process is integral to the light-dependent reactions of photosynthesis, where ATP produced by the ATP synthase is used along with NADPH to power carbon fixation and other metabolic processes. The regulation of ATP synthase activity significantly impacts the proton gradient (ΔpH) across thylakoid membranes, which in turn affects photosynthetic electron flow and photoprotection mechanisms .

How does the structure of recombinant Glycine max atpI differ from native protein?

Recombinant Glycine max atpI typically maintains the core structural features of the native protein but incorporates specific modifications to facilitate expression, purification, and experimental manipulation. These modifications commonly include:

  • Addition of affinity tags (His6, GST, or FLAG tags) at either the N- or C-terminus to enable efficient purification

  • Introduction of protease cleavage sites to remove affinity tags after purification

  • Codon optimization for the expression host system (typically E. coli, yeast, or insect cells)

  • Potential removal of transit peptide sequences that target the native protein to chloroplasts

  • Introduction of point mutations to enhance stability or solubility

The core transmembrane domains that form the proton channel remain conserved in properly designed recombinant constructs, though researchers should verify functional integrity through complementation assays or reconstitution experiments to ensure that modifications do not disrupt critical interactions within the ATP synthase complex.

What expression systems are most effective for producing recombinant Glycine max atpI?

The expression of chloroplastic membrane proteins like atpI presents significant challenges due to their hydrophobicity and complex folding requirements. Based on research methodologies for similar proteins, the following expression systems offer distinct advantages:

Expression SystemAdvantagesLimitationsTypical Yield
E. coli- Rapid growth
- Low cost
- Genetic tractability
- Established protocols
- Potential improper folding
- Inclusion body formation
- Lack of post-translational modifications
0.1-2 mg/L culture
Insect cells- Better folding machinery
- Post-translational modifications
- Higher yields of functional protein
- Higher cost
- Longer expression time
- More complex methodology
1-5 mg/L culture
Cell-free systems- Direct access to reaction conditions
- Addition of detergents/lipids during synthesis
- Rapid expression
- High cost
- Limited scale
- Specialized equipment required
0.5-3 mg/L reaction

For atpI specifically, researchers have found success using E. coli strains specialized for membrane protein expression (C41(DE3), C43(DE3), or Lemo21(DE3)) with careful optimization of induction conditions (temperature, inducer concentration, and expression duration). The protein should be extracted using mild detergents (DDM, LDAO, or C12E8) that maintain structural integrity while effectively solubilizing the protein from membranes.

What are the optimal purification strategies for recombinant Glycine max atpI?

Purification of recombinant atpI requires specialized approaches due to its hydrophobic nature. A methodological purification protocol would involve:

  • Membrane fraction isolation: Harvest cells and lyse them using mechanical disruption (sonication, French press, or homogenization). Collect membrane fractions by ultracentrifugation (typically 100,000 × g for 1 hour).

  • Solubilization: Resuspend membrane pellets in buffer containing an appropriate detergent. For atpI, n-dodecyl-β-D-maltopyranoside (DDM) at 1-2% is often effective. Incubate with gentle agitation at 4°C for 1-2 hours, followed by ultracentrifugation to remove insoluble material.

  • Affinity chromatography: Apply the solubilized fraction to an appropriate affinity resin (typically Ni-NTA for His-tagged constructs). Wash with buffer containing reduced detergent concentration (0.05-0.1% DDM) and elute with an imidazole gradient or step elution.

  • Size exclusion chromatography: Further purify the protein using size exclusion chromatography to remove aggregates and ensure homogeneity.

  • Quality assessment: Verify purity using SDS-PAGE and Western blotting, and assess functional integrity through reconstitution assays or ATPase activity measurements.

Throughout purification, it is critical to maintain the protein in detergent micelles or reconstitute it into lipid nanodiscs or proteoliposomes to prevent aggregation and denaturation. Yields of 0.2-1 mg of purified protein per liter of culture can typically be achieved with optimized protocols.

How can researchers assess the functional integrity of purified recombinant atpI?

Assessing the functional integrity of recombinant atpI is crucial for experimental validity. Several complementary approaches should be employed:

  • Proton conductance assays: Reconstitute purified atpI into liposomes containing pH-sensitive fluorescent dyes (such as ACMA or pyranine). Monitor fluorescence changes upon the establishment of a pH gradient to assess proton translocation capability.

  • Reconstitution with other ATP synthase subunits: Combine purified atpI with other ATP synthase components to reconstitute the functional complex. Assess ATP synthesis activity using luciferin/luciferase assays in the presence of an artificially imposed proton gradient.

  • Thermostability assays: Use differential scanning fluorimetry or circular dichroism to assess protein stability and folding, comparing with native protein where possible.

  • Binding studies: Evaluate interactions with known binding partners (other ATP synthase subunits) using techniques such as surface plasmon resonance, isothermal titration calorimetry, or pull-down assays.

  • In vivo complementation: Express the recombinant atpI in ATP synthase-deficient mutants to assess functional rescue, which provides the most physiologically relevant assessment of activity.

These combined approaches provide a comprehensive evaluation of both structural integrity and functional capacity of the recombinant protein.

How does atpI contribute to the regulation of proton motive force (pmf) during changing environmental conditions?

The ATP synthase complex, including the atpI subunit, plays a crucial role in regulating proton motive force (pmf) across thylakoid membranes, especially under changing environmental conditions. Research has shown that:

At low temperatures (e.g., 6°C), the activity of chloroplastic ATP synthase (measured as proton conductance, gH+) is significantly reduced compared to optimal temperatures (25°C), regardless of light intensity . This reduced ATP synthase activity helps maintain a higher proton gradient (ΔpH) across the thylakoid membrane during cold stress conditions.

The regulatory mechanism appears to involve:

  • Thermodynamic regulation by the stromal ATP/ADP ratio, which increases at low temperatures due to restricted CO2 assimilation and decreased availability of ADP and Pi .

  • The reduced activity of ATP synthase at low temperatures contributes to increased ΔpH, which in turn:

    • Slows down electron transfer from PSII to PSI

    • Maintains PSI in a more oxidized state

    • Prevents over-reduction of PSI and subsequent reactive oxygen species (ROS) production

    • Protects against photoinhibition of PSI under chilling-light stress conditions

This adaptive response demonstrates that atpI and the ATP synthase complex are not merely passive components of energy conversion but active regulators of photosynthetic electron flow under stress conditions. Experimental approaches to study this include:

  • Measuring electrochromic shift (ECS) signals to quantify pmf and gH+ under various temperature and light conditions

  • Analyzing P700 oxidation states to assess PSI redox status

  • Measuring non-photochemical quenching (NPQ) as an indicator of ΔpH formation

  • Comparing wild-type and ATP synthase-modified plants under stress conditions

What methodologies are most effective for studying atpI interactions with other ATP synthase subunits?

Investigating protein-protein interactions involving membrane proteins like atpI requires specialized techniques. The following methodologies are particularly effective:

  • Crosslinking mass spectrometry (XL-MS): Chemical crosslinkers of varying lengths can be used to capture interactions between atpI and neighboring subunits. After crosslinking, digest the protein complex and analyze by mass spectrometry to identify crosslinked peptides, providing spatial constraints for modeling interactions.

  • Co-immunoprecipitation with specific antibodies: Develop antibodies against atpI or use epitope tags, then perform co-IP experiments to identify interacting partners. This approach can be enhanced with chemical crosslinking to stabilize transient interactions.

  • FRET-based approaches: Generate fluorescently labeled versions of atpI and potential interacting partners (using either genetically encoded fluorescent proteins or chemical labeling strategies) and measure Förster resonance energy transfer to assess proximity in reconstituted systems.

  • Cryo-electron microscopy: Recent advances in cryo-EM make it possible to determine structures of membrane protein complexes at near-atomic resolution. This approach can reveal the structural basis of atpI interactions within the ATP synthase complex.

  • Genetic approaches: Yeast two-hybrid variants designed for membrane proteins (such as split-ubiquitin or MYTH systems) can identify potential interactions, though these should be validated with more direct biophysical methods.

  • Computational approaches: Molecular dynamics simulations can predict interactions and their dynamics, especially when informed by partial experimental constraints from other methods.

A comprehensive understanding typically requires combining multiple complementary approaches, starting with more high-throughput methods to identify candidates, followed by detailed biophysical characterization of specific interactions.

How do mutations in Glycine max atpI affect proton translocation and ATP synthesis efficiency?

Structure-function analysis of atpI through site-directed mutagenesis can provide valuable insights into the mechanism of proton translocation. Key residues in atpI that typically warrant investigation include:

  • Charged residues within transmembrane segments that may form part of the proton pathway

  • Highly conserved residues identified through comparative genomics

  • Residues at predicted interfaces with other ATP synthase subunits

  • Residues implicated in proton translocation based on homology with bacterial ATP synthases

A systematic mutagenesis approach might examine:

Mutation TypeExpected EffectDetection Method
Charge-neutralizing mutations (Arg/Lys→Ala, Glu/Asp→Ala)Disruption of proton pathwayReduced proton translocation activity
Conservative substitutions (Arg→Lys, Glu→Asp)Minimal effects if position is not criticalMaintained function with slight alterations in efficiency
Introduction of bulky residuesSteric hindrance affecting subunit interactionsDisrupted complex assembly, detected by BN-PAGE
Cysteine substitutionsIntroduction of sites for chemical modification or crosslinkingEnables accessibility studies and targeted labeling

Functional consequences can be assessed through:

  • Reconstitution of mutant proteins into liposomes to measure proton translocation rates

  • Assembly of the ATP synthase complex with mutant atpI to measure ATP synthesis rates

  • Thermostability assays to assess structural impact of mutations

  • In vivo complementation studies to evaluate physiological significance

These experiments would enable mapping of functionally critical regions of atpI and provide insights into the molecular mechanism of proton translocation through the ATP synthase complex.

What role does atpI play in ATP:NADPH ratio regulation during stress conditions?

The chloroplastic ATP synthase complex, including atpI, plays a critical role in maintaining balanced ATP:NADPH ratios during photosynthesis, particularly under stress conditions. Based on metabolic modeling studies of soybean:

The ATP:NADPH maintenance ratio significantly impacts metabolic fluxes in plant tissues. When this ratio is altered, several metabolic adjustments occur:

  • Tricarboxylic acid (TCA) cycle flux increases with higher ATP:NADPH ratios .

  • The oxidative pentose phosphate pathway (OxPPP) activity decreases with increasing ATP:NADPH ratios .

  • At higher ATP:NADPH ratios (4:1, 5:1, 10:1), the plastidic NADP-dependent malic enzyme predominates, while at lower ratios (2:1, 3:1), the cytosolic form predominates .

The activity of ATP synthase directly influences these ratios by controlling ATP production. Under stress conditions such as chilling, where ATP synthase activity (gH+) is reduced , the altered ATP:NADPH ratio triggers metabolic adjustments to maintain energy balance.

Experimental approaches to investigate this regulation include:

  • Metabolic flux analysis using isotope labeling experiments to trace carbon flow through different pathways under varying ATP:NADPH ratios

  • Proteomics and enzyme activity assays to identify regulatory mechanisms affecting ATP synthase activity

  • Genetic manipulation of atpI expression or activity to assess the impact on ATP:NADPH ratios and metabolic adjustments

  • Measurement of redox states of electron carriers in the photosynthetic electron transport chain under different ATP synthase activity levels

Understanding this regulation is crucial for developing strategies to enhance plant performance under stress conditions by optimizing energy conversion processes.

How can researchers effectively reconstitute recombinant atpI into functional membrane systems for biophysical studies?

Reconstitution of recombinant atpI into artificial membrane systems is essential for detailed biophysical characterization. The following methodological approach ensures successful reconstitution:

  • Selection of appropriate lipid composition:

    • Use plant thylakoid-mimicking lipid mixtures (MGDG, DGDG, SQDG, and PG at ratios approximating thylakoid membranes)

    • Incorporate fluorescent or spin-labeled lipids for specific biophysical studies

    • Maintain appropriate lipid-to-protein ratios (typically 50:1 to 200:1 by weight)

  • Reconstitution methods:

    • Detergent removal approaches:

      • Dialysis against detergent-free buffer (slow but gentle)

      • Bio-Beads or amberlite XAD-2 adsorption (faster but requires optimization)

      • Cyclodextrin-mediated detergent extraction (rapid and controllable)

    • Direct incorporation methods:

      • Inclusion during liposome formation via sonication or extrusion

      • Fusion of protein-containing nanodiscs with preformed liposomes

  • Verification of successful reconstitution:

    • Freeze-fracture electron microscopy to visualize protein distribution

    • Proteolytic digestion to assess protein orientation

    • Dynamic light scattering to assess proteoliposome size distribution

    • Fluorescence recovery after photobleaching (FRAP) to measure lateral mobility

    • Functional assays (proton translocation, ATPase activity)

  • Advanced membrane systems:

    • Nanodiscs: Provide a native-like environment for individual protein molecules

    • Giant unilamellar vesicles (GUVs): Allow visualization by optical microscopy

    • Supported lipid bilayers: Enable surface-based analytical techniques

    • Droplet interface bilayers: Permit electrical measurements

These reconstituted systems serve as platforms for various biophysical studies, including single-molecule fluorescence spectroscopy, atomic force microscopy, solid-state NMR, and electrophysiological measurements to characterize atpI structure, dynamics, and function at the molecular level.

How does atpI contribute to photoprotection mechanisms during environmental stress conditions?

The chloroplastic ATP synthase, including the atpI subunit, plays a crucial role in photoprotection during environmental stress, particularly under chilling-light stress conditions. Research has revealed:

Under chilling conditions (6°C) and high light, reduced ATP synthase activity (measured as proton conductance, gH+) contributes significantly to photoprotection through several interrelated mechanisms:

  • Increased thylakoid lumen acidification (higher ΔpH) due to restricted proton efflux through the ATP synthase .

  • The elevated ΔpH triggers non-photochemical quenching (NPQ), which safely dissipates excess excitation energy as heat at the PSII antenna .

  • The higher ΔpH also slows down electron transfer from PSII to PSI, preventing over-reduction of PSI and subsequent formation of reactive oxygen species (ROS) .

  • Maintenance of a higher oxidation state of PSI (P700+), which protects PSI from photoinhibition under stress conditions .

These findings highlight that ATP synthase is not merely an ATP-producing enzyme but a key regulator of photoprotection. Molecular mechanisms may involve:

  • Structural changes in atpI that affect proton conductance at low temperatures

  • Regulatory interactions with other proteins or lipids that modulate ATP synthase activity

  • Post-translational modifications of ATP synthase subunits in response to stress signals

Future experimental approaches should focus on:

  • Site-directed mutagenesis of atpI to identify residues critical for regulatory responses

  • Time-resolved spectroscopic measurements to correlate ATP synthase activity with photoprotective mechanisms

  • Comparison of natural variants of atpI from plants adapted to different temperature regimes

What techniques are most effective for studying the dynamic behavior of atpI within the ATP synthase complex?

Understanding the dynamic behavior of atpI requires sophisticated biophysical approaches that can capture conformational changes and molecular movements during the catalytic cycle. The following methodologies are particularly valuable:

  • Single-molecule FRET spectroscopy:

    • Introduce fluorescent labels at strategic positions in atpI and other subunits

    • Measure distance changes between labeled positions during ATP synthesis/hydrolysis

    • Track rotary movements of the c-ring relative to atpI during catalysis

    • Provides time-resolved information about conformational dynamics

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Expose the ATP synthase complex to deuterated buffer for various time periods

    • Analyze the rate of hydrogen-deuterium exchange in different regions of atpI

    • Identify regions with differential solvent accessibility or structural flexibility

    • Compare exchange patterns under different functional states (e.g., active vs. inhibited)

  • Molecular dynamics simulations:

    • Develop atomic models of atpI within the ATP synthase complex

    • Simulate proton movement through the atpI/c-ring interface

    • Predict conformational changes in response to protonation/deprotonation events

    • Test hypotheses about the mechanism of proton translocation

  • Cryo-electron microscopy with classification analysis:

    • Capture the ATP synthase complex in different conformational states

    • Use 3D classification to identify distinct structural configurations

    • Develop models of the conformational cycle during catalysis

    • Identify specific movements of atpI relative to other subunits

  • Site-directed spin labeling EPR spectroscopy:

    • Introduce spin labels at specific positions in atpI

    • Measure distances between labeled sites using DEER/PELDOR techniques

    • Monitor changes in local environment and mobility at specific residues

    • Characterize conformational changes under different physiological conditions

These techniques provide complementary information about the structure, dynamics, and function of atpI, enabling researchers to develop comprehensive models of how this subunit contributes to the remarkable molecular machinery of ATP synthase.

How can metabolic flux analysis be used to investigate the role of ATP synthase in balancing energy requirements in Glycine max?

Soybean metabolic modeling has revealed that varying the ATP:NADPH maintenance ratio from 1:1 to 10:1 significantly impacts metabolic flux distributions, particularly affecting the tricarboxylic acid cycle, glyoxylate cycle, and oxidative pentose phosphate pathway activities . These findings highlight the central role of ATP synthase in coordinating energy metabolism through its effect on cellular ATP levels.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.