Recombinant Glycine max CASP-like protein 1

Shipped with Ice Packs
In Stock

Description

Production and Expression Systems

Recombinant Glycine max CASP-like protein 1 is synthesized in multiple host systems to optimize yield and functionality:

Host SystemTagProtein LengthSource
E. coliN-terminal HisFull Length (1–186)Creative BioMart
YeastN/APartialCusabio
BaculovirusN/AFull LengthCusabio
Mammalian cellsN/AFull LengthCusabio

The E. coli-expressed version includes an N-terminal His tag for purification and is lyophilized in a Tris/PBS-based buffer with 6% trehalose .

Purity and Stability

  • Purity: >90% as confirmed by SDS-PAGE .

  • Storage: Stable at −20°C/−80°C in aliquots; repeated freeze-thaw cycles are discouraged. Working aliquots should be stored at 4°C for ≤1 week .

  • Reconstitution: Recommended in deionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage .

Comparative Analysis of Expression Systems

The choice of host system influences protein yield, solubility, and post-translational modifications:

ParameterE. coli Yeast Baculovirus
Protein LengthFull Length (1–186)PartialFull Length
Tag AvailabilityHis tagN/AN/A
ApplicationsHigh-yield, cost-effectiveEukaryotic post-translational modsComplex folding, membrane proteins

Research Challenges and Future Directions

  • Functional Elucidation: Limited data exist on the protein’s biological role in Glycine max. Further studies are needed to link its structure to specific cellular processes.

  • Biotechnological Utility: Its recombinant form could serve as a model for studying CASP-like protein evolution or engineering membrane-associated proteins.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary based on the purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing it accordingly.
Synonyms
CASP-like protein 7; GmCASP7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Glycine max (Soybean) (Glycine hispida)
Target Protein Sequence
MKGGSIEAGEVSKDASPRKGVARGLSIMDFILRIIAAVATLGSALAMGTTNETLPFATQF IKFRAEFDDLPSLVFFVMANAVVCGYLVLSLMISVFHILRSTPVKSRILLVALDTVMLSL VTASASAATSIVYIAHNGNTGANWFAICQQYNNFCERISGSLIGSYIAVALFIILIMLSL VAISRN
Uniprot No.

Target Background

Function
Regulates membrane-cell wall junctions and localized cell wall deposition. It is crucial for establishing the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips, a cell wall modification of the root endodermis. The Casparian strip acts as an apoplastic barrier between the intraorganismal apoplasm and the extraorganismal apoplasm, preventing lateral diffusion.
Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Glycine max CASP-like protein 1 and how does it relate to Casparian strip membrane proteins?

Glycine max CASP-like protein 1 belongs to the CASP-like protein family that shares homology with Casparian strip membrane domain proteins (CASPs). CASPs are four-transmembrane proteins that form specialized membrane domains and contribute to the modification of cell walls . While classic CASPs function primarily in the endodermis to create membrane fences, CASP-like proteins such as those found in Glycine max may serve analogous roles in other tissue types or cellular processes. CASP-like proteins contain conserved extracellular loops (EL1 and EL2) that are critical for their proper localization and function .

What is the structural composition of recombinant Glycine max CASP-like protein 1?

Recombinant Glycine max CASP-like protein 1 consists of 186 amino acids in its full-length form . When expressed as a recombinant protein, it is typically produced with affinity tags such as a histidine tag to facilitate purification . Based on structural analysis of related CASP proteins, Glycine max CASP-like protein 1 likely contains four transmembrane domains with two extracellular loops and cytoplasmic N- and C-termini. The protein may contain conserved cysteine residues in the extracellular loops that are important for proper folding and function, similar to those identified in other CASP proteins (such as C168 and C175 in Arabidopsis CASP1) .

What cellular localization patterns are expected for Glycine max CASP-like protein 1?

Based on studies of related CASP proteins, Glycine max CASP-like protein 1 likely exhibits specific membrane localization patterns. CASP proteins typically start with broad plasma membrane localization before becoming restricted to specialized membrane domains. For example, Arabidopsis CASP1 is initially targeted to the whole plasma membrane before being removed from lateral membranes to remain exclusively at the Casparian strip membrane domain (CSD), where it shows extremely low turnover . By analogy, Glycine max CASP-like protein 1 may exhibit similar dynamic localization patterns, potentially forming specialized membrane domains in soybean cells relevant to its biological function.

What expression systems are optimal for producing recombinant Glycine max CASP-like protein 1?

The optimal expression system for recombinant Glycine max CASP-like protein 1 is E. coli, as demonstrated by commercially available preparations . When establishing an expression protocol, researchers should consider:

  • Vector selection: pET-series vectors with strong T7 promoters are commonly used for high-yield expression

  • Tags: His-tag fusion at either N- or C-terminus facilitates purification while maintaining protein functionality

  • Expression conditions: Induction parameters (IPTG concentration, temperature, duration) should be optimized to maximize soluble protein yield

  • Bacterial strain: BL21(DE3) or Rosetta strains may enhance expression of plant proteins with rare codons

For membrane proteins like CASP-like protein 1, expression conditions that reduce inclusion body formation (such as lower induction temperatures of 16-20°C) may improve the yield of functional protein.

What methods are effective for studying protein-protein interactions involving Glycine max CASP-like protein 1?

Based on methodologies used to study related proteins, several techniques are particularly effective for investigating Glycine max CASP-like protein 1 interactions:

  • Yeast Two-Hybrid (Y2H): Used successfully to identify t-SNARE interactions with α-SNAP proteins in soybean .

  • Bimolecular Fluorescence Complementation (BiFC): Effective for visualizing protein interactions in planta, as demonstrated with DSP1β interactions .

  • Co-immunoprecipitation (Co-IP): Provides biochemical validation of interactions identified through screening methods. This approach effectively demonstrated interactions between DSP1β and CPSF73-I .

  • Pull-down assays with recombinant proteins: GST-tagged or His-tagged proteins can be used to identify direct binding partners from cell lysates.

For membrane proteins like CASP-like protein 1, membrane yeast two-hybrid systems or split-ubiquitin assays may provide better results than conventional Y2H when testing interactions with other membrane-associated proteins.

What purification strategies yield the highest purity for recombinant Glycine max CASP-like protein 1?

A multi-step purification strategy is recommended for obtaining high-purity Glycine max CASP-like protein 1:

  • Immobilized metal affinity chromatography (IMAC): For His-tagged recombinant protein, using Ni-NTA or Co-NTA columns with optimized imidazole gradients for elution .

  • Size-exclusion chromatography: To separate monomeric protein from aggregates and remove remaining impurities.

  • Ion-exchange chromatography: As a polishing step to achieve higher purity if needed.

For membrane-associated proteins like CASP-like protein 1, inclusion of mild detergents (0.1% Triton X-100 or 0.5-1% CHAPS) in buffers may improve solubility and prevent aggregation during purification. Detergent screening is recommended to identify conditions that maintain native protein structure.

What is the potential role of Glycine max CASP-like protein 1 in soybean cyst nematode resistance?

While direct evidence linking Glycine max CASP-like protein 1 to soybean cyst nematode (SCN) resistance is not explicitly stated in the available data, related research suggests potential mechanisms for investigation:

The Rhg1 locus, which contains an α-SNAP protein, is crucial for SCN resistance in soybean. This α-SNAP strongly interacts with two syntaxins of the t-SNARE family (Glyma.12G194800 and Glyma.16G154200), and these interactions are essential for SCN resistance . Since membrane organization is critical for both CASP-like proteins and SNARE-mediated vesicle trafficking, CASP-like protein 1 might contribute to resistance mechanisms by:

  • Establishing specialized membrane domains that facilitate SNARE protein clustering

  • Modifying cell wall properties at sites of nematode feeding structure formation

  • Contributing to compartmentalization of defense responses through membrane domain organization

Research approaches to test these hypotheses could include:

  • CRISPR-Cas9 modification of CASP-like protein 1 genes in resistant soybean lines followed by SCN challenge

  • Co-localization studies with known SCN resistance proteins

  • Transcriptional analysis of CASP-like protein 1 expression during nematode infection

How might alternative splicing affect the function of Glycine max CASP-like proteins?

Alternative splicing can significantly impact protein function, as demonstrated in the case of DSP1 where different splice variants (DSP1α and DSP1β) have distinct roles in snRNA biogenesis . For Glycine max CASP-like proteins, alternative splicing could:

  • Generate variants with different transmembrane domain organizations, affecting membrane localization

  • Produce isoforms with altered extracellular loops, modifying protein-protein interactions or cell wall binding properties

  • Create variants with different C-terminal domains that interact with distinct cytoplasmic partners

The research on DSP1 provides a methodological framework for investigating alternative splicing in CASP-like proteins:

  • RT-PCR with primer pairs recognizing various positions of the gene to detect potential splice variants

  • Functional complementation assays to test the ability of different splice variants to rescue mutant phenotypes

  • Protein interaction studies to identify binding partners specific to different splice variants

  • Localization studies to determine if splice variants exhibit different subcellular distribution patterns

What are the critical conserved residues in Glycine max CASP-like protein 1 and how do they affect function?

Based on studies of related CASP proteins, several conserved residues are likely critical for Glycine max CASP-like protein 1 function:

  • Conserved cysteines in extracellular loops: In Arabidopsis CASP1, mutations in C168 and C175 affected protein localization . These residues likely form disulfide bridges essential for proper protein folding and stability.

  • Conserved aromatic residues: The W164 and F174 residues in Arabidopsis CASP1 are important for localization . W164G mutation showed the strongest effect, with the protein being initially excluded from the Casparian strip membrane domain.

  • Glycine residues: G158 in Arabidopsis CASP1 is important for proper localization .

To determine critical residues in Glycine max CASP-like protein 1, researchers should:

  • Perform sequence alignment with characterized CASP proteins

  • Identify highly conserved residues, particularly in extracellular loops

  • Generate site-directed mutants of these residues

  • Assess effects on protein localization, stability, and function through in vivo expression studies

What domains and motifs are essential for Glycine max CASP-like protein 1 function?

Based on studies of related CASP proteins, several key domains and motifs are likely essential for Glycine max CASP-like protein 1 function:

Domain/MotifLocationPredicted Function
Extracellular Loop 1 (EL1)Between TM1-TM2Protein-protein interactions, membrane domain formation
Extracellular Loop 2 (EL2)Between TM3-TM4Contains conserved residues critical for localization
Transmembrane domainsTM1-TM4Membrane anchoring, potential oligomerization
C-terminal regionAfter TM4Potential cytoplasmic interactions

The EL1 region appears particularly important in CASP proteins, with high conservation among functional family members but divergence in species lacking the corresponding function . For instance, in Utricularia gibba, which lacks true roots, the closest CASP homolog shows clear divergence of the entire EL1 region .

For functional analysis of these domains, researchers should consider:

  • Generating chimeric proteins where domains are swapped between CASP-like proteins with different functions

  • Creating deletion mutants to assess the contribution of specific regions

  • Performing alanine-scanning mutagenesis of conserved motifs

What techniques are most effective for studying CASP-like protein membrane localization?

Several complementary techniques are recommended for studying the membrane localization of Glycine max CASP-like protein 1:

  • Fluorescent protein fusions: C-terminal or N-terminal GFP/mCherry fusions allow visualization of dynamic localization patterns in living cells, as demonstrated with AtCASP1-mCherry .

  • Immunolocalization: Using specific antibodies against the protein or epitope tags for higher resolution localization studies in fixed tissues.

  • Membrane fractionation: Biochemical separation of different membrane compartments followed by western blotting to determine the distribution of the protein.

  • FRAP (Fluorescence Recovery After Photobleaching): To assess protein mobility within membranes and determine if the protein forms stable domains similar to CASPs.

  • Super-resolution microscopy: Techniques such as STORM or PALM provide nanoscale resolution of protein organization within membrane domains.

For optimal results when studying CASP-like protein localization, researchers should:

  • Use native promoters rather than constitutive promoters to maintain physiological expression levels

  • Confirm that fluorescent protein fusions are functional through complementation assays

  • Include membrane markers for different compartments as co-localization references

  • Perform time-course studies to capture dynamic changes in localization

How can researchers assess the impact of mutations on Glycine max CASP-like protein 1 function?

To systematically assess the impact of mutations on Glycine max CASP-like protein 1 function, researchers should implement a multi-faceted approach:

  • Site-directed mutagenesis: Target conserved residues identified through sequence alignment with well-characterized CASPs. Studies of Arabidopsis CASP1 showed that mutations in conserved residues (C168S, F174V, C175S, G158S, W164G) affected protein localization to varying degrees .

  • Complementation assays: Express mutated versions in knockout or knockdown lines to assess functional rescue.

  • Localization studies: Track changes in membrane localization patterns using fluorescent protein fusions, as demonstrated with AtCASP1 variants .

  • Protein-protein interaction assays: Determine if mutations affect interactions with binding partners using techniques like BiFC or Co-IP.

  • Phenotypic analysis: Assess physiological consequences of mutations, particularly in processes where CASP-like proteins are implicated (e.g., defense responses).

A systematic experimental design might include:

  • Creation of a mutation series targeting different protein regions

  • Progressive mutation of conserved residues to assess additive effects

  • Parallel analysis of localization, interaction, and function for each mutant

  • Correlation of molecular defects with physiological consequences

How conserved are CASP-like proteins across plant species?

CASP-like proteins show interesting patterns of conservation across plant species that reflect their functional significance:

  • Number of family members: Most plant genomes contain multiple CASP-like proteins. For example, the genomes of Utricularia gibba and Mimulus guttatus each contain over 20 CASP homologs .

  • Conservation of key motifs: The EL1 (extracellular loop 1) signature sequence is particularly well conserved among functional CASP proteins. In Mimulus guttatus, six CASP homologs contain the EL1 signature, with three showing perfect conservation and three showing single-residue divergence .

  • Functional correlation: The conservation pattern of specific domains correlates with functional specialization. For instance, Utricularia gibba, which lacks true roots, shows clear divergence of the EL1 sequence in its closest CASP homolog - only two residues are identical to the Arabidopsis CASP EL1 stretch .

To study conservation patterns of Glycine max CASP-like protein 1, researchers should:

  • Perform phylogenetic analysis across diverse plant species

  • Analyze domain-specific conservation rates

  • Correlate sequence conservation with functional data where available

  • Consider tissue-specific expression patterns in different species

What differences exist between Glycine max CASP-like protein 1 and other members of the CASP-like family?

While specific data comparing Glycine max CASP-like protein 1 with other family members is limited in the provided information, the following comparative approach is recommended:

FeatureCASP-like protein 1CASP-like protein 9Other family members
Protein length186 amino acids 194 amino acids Variable
Expression patternTo be determinedTo be determinedTo be determined
Subcellular localizationPresumed membranePresumed membraneMay vary
Interaction partnersTo be determinedTo be determinedTo be determined

To comprehensively characterize the differences between family members, researchers should:

  • Perform sequence alignment to identify unique regions in each protein

  • Compare expression patterns using publicly available transcriptome data

  • Assess subcellular localization patterns using tagged constructs

  • Identify specific interaction partners for each family member

  • Generate family member-specific knockout/knockdown lines to assess non-redundant functions

How can structural modeling contribute to understanding CASP-like protein functional diversity?

Structural modeling can provide valuable insights into the functional diversity of CASP-like proteins despite the challenges associated with membrane protein structure determination:

  • Homology modeling: Using solved structures of related membrane proteins as templates to predict the 3D structure of Glycine max CASP-like protein 1.

  • Transmembrane domain prediction: Tools like TMHMM, Phobius, and TOPCONS can predict the arrangement of transmembrane helices.

  • Extracellular loop modeling: Since extracellular loops contain critical functional residues in CASP proteins , specialized loop modeling can identify potential interaction surfaces.

  • Molecular dynamics simulations: To study protein behavior in membrane environments and predict how mutations might affect structure and dynamics.

  • Evolutionary coupling analysis: To identify co-evolving residues that might be structurally or functionally linked.

Specific approaches for Glycine max CASP-like protein 1 could include:

  • Comparative modeling based on the four-transmembrane topology

  • Mapping conserved residues onto the predicted structure

  • Docking simulations with potential interaction partners

  • In silico mutagenesis to predict the impact of mutations on structure

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.