Recombinant Glycine max CASP-like protein 12

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Glycine max (soybean) CASP-like protein 12 belongs to the CASPARIAN STRIP MEMBRANE DOMAIN PROTEIN (CASP) family, which plays critical roles in plant root development by forming lignin-based Casparian strips. These transmembrane proteins act as scaffolds to compartmentalize plasma membranes and direct cell wall modifications . While CASP-like proteins are well-studied in Arabidopsis thaliana, their homologs in soybean (Glycine max) remain under investigation. Recombinant versions, such as CASP-like protein 12, are engineered to study their structural and functional properties or for biotechnological applications.

Functional Insights

Role in Plant Physiology:

  • CASP-like proteins mediate lignin polymerization by recruiting peroxidases, forming apoplastic barriers in roots .

  • In Arabidopsis, CASP1–CASP5 stabilize membrane domains and restrict protein diffusion, enabling nutrient transport regulation .

Biotechnological Applications:

  • Recombinant CASP-like proteins are used to study membrane scaffold formation. For example, extracellular loops are dispensable for CASP1 localization but critical for lignin deposition .

  • Fusion of 3’UTRs from seed storage protein genes (e.g., 12S1) enhances recombinant protein yields in Arabidopsis, suggesting strategies for optimizing CASP-like protein production .

Production and Engineering

Expression Systems:

  • Recombinant proteins in plants are often produced using codon-optimized constructs in E. coli or yeast . For example, CRISPR-Cas9 has enabled multiplex gene editing in CHO cells to reduce host cell proteins (HCPs), a technique adaptable to plant systems .

Key Challenges:

  • Low solubility and inclusion body formation in E. coli require fusion tags (e.g., His, MBP) or chaperone co-expression .

  • Post-translational modifications (e.g., glycosylation) may necessitate mammalian or plant-based systems .

Comparative Analysis of CASP-like Proteins in Glycine Species

Gene IDSpeciesAnnotationGenomic StatusExpression Pattern
Glyma06g45810Glycine sojaCASP-like proteinSingle copyHigher in G. max
C6SZ04Glycine maxCASP-like protein 3RecombinantFull-length (1–180 aa)
HypotheticalGlycine maxCASP-like protein 12UndeterminedInferred from homologs

Research Gaps and Future Directions

  • Structural Data: No crystal or NMR structures for Glycine max CASP-like protein 12 are available. Homology modeling using Arabidopsis CASP1 (PDB: 5FS4) could provide insights .

  • Functional Validation: Knockout mutants (e.g., CRISPR-edited soybean lines) are needed to confirm roles in root development .

  • Industrial Use: Leveraging 3’UTR fusion strategies (as in 12S1 ) could enhance recombinant CASP-like protein yields for agricultural biotechnology.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us; we will prioritize fulfilling your request.
Synonyms
CASP-like protein 4D1; GmCASPL4D1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Glycine max (Soybean) (Glycine hispida)
Target Protein Sequence
MPEMVDSNSTPSSSTGSRTVLLLLRVLTFVFLLIALILIAIVKQTDDETGVEIKFNDIYA YRYMISTIIIGFAYNLLQMALSIFTVVSGNRVLSGDGGYLFDFFGDKIISYLLISGSAAG FGVTVELGRGVPSNSFMDKANASASLLLIAFLFTAVASTFTSFALPKKD
Uniprot No.

Target Background

Database Links

KEGG: gmx:100500517

UniGene: Gma.26613

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Glycine max CASP-like protein 12 and how is it classified within plant protein families?

Glycine max CASP-like protein 12 is a plant protein belonging to the CASP-like (Casparian Strip membrane domain Protein-Like) family found in soybeans (Glycine max). It is also referred to as CASP-like protein 4D1 or GmCASPL4D1 in scientific literature. The protein consists of 169 amino acids and is typically expressed with an N-terminal His-tag for research purposes .

CASP proteins represent a specialized family originally identified for their role in forming Casparian strips in plant roots. These proteins are involved in generating plasma membrane domains and modifying cell walls through interaction with various enzymes, including peroxidases. They function both by making membrane scaffolds and by directing modifications of the cell wall, with these activities being potentially separable functions .

How can researchers predict the functional domains of Glycine max CASP-like protein 12?

Predicting functional domains in Glycine max CASP-like protein 12 requires a multi-faceted approach combining computational analysis with experimental validation:

  • Sequence homology analysis: Comparing the sequence with better-characterized CASP proteins, particularly from model plants like Arabidopsis, can reveal conserved domains. Studies on Arabidopsis CASP1 have identified important extracellular loops (ELs) where mutations affect localization .

  • Transmembrane domain prediction: Tools like TMHMM, Phobius, or TOPCONS can identify potential membrane-spanning regions.

  • Conserved motif analysis: Studies of CASP proteins have shown that certain residues in extracellular loops are particularly important. For example, in Arabidopsis CASP1, mutations in extracellular loop 2 (EL2) affect protein localization to varying degrees, with residues like W164 being particularly critical .

  • Structural modeling: Although specific structural data for this protein is limited, computational approaches like homology modeling can provide insights into domain organization.

  • Experimental validation: Site-directed mutagenesis targeting conserved residues followed by functional assays is essential to confirm predicted domains.

Research on related CASP proteins suggests that both transmembrane domains and extracellular loops contribute to function, with certain highly conserved residues being particularly important for proper localization and activity .

What are the optimal expression systems for recombinant Glycine max CASP-like protein 12?

The optimal expression system for recombinant Glycine max CASP-like protein 12 depends on research objectives, with E. coli being the most validated approach. Based on commercial production protocols, E. coli has been successfully employed to express the full-length protein (1-169aa) with an N-terminal His-tag . This system offers several advantages for research applications:

E. coli Expression Protocol Overview:

  • Gene optimization: Codon optimization for E. coli expression

  • Vector selection: pET or similar expression vectors with T7 promoter

  • Fusion tag: N-terminal His-tag for purification purposes

  • Induction conditions: Typically IPTG induction at reduced temperatures (16-25°C)

  • Cell lysis: Often requiring detergent solubilization due to membrane association

For researchers requiring post-translational modifications or studying protein-protein interactions, alternative systems may be considered:

  • Yeast systems (P. pastoris): Better for membrane proteins requiring eukaryotic processing

  • Plant-based expression: For native modifications, though with lower yields

  • Cell-free systems: For rapid screening of construct designs

The selection of expression system should be guided by the specific experimental requirements, with E. coli offering the most cost-effective and established protocol for basic structural and functional studies .

What purification strategies yield high-purity recombinant Glycine max CASP-like protein 12?

Purification of recombinant Glycine max CASP-like protein 12 requires a strategic approach to achieve high purity while maintaining protein integrity. Based on established protocols, the following multi-step purification strategy is recommended:

Primary Purification: Immobilized Metal Affinity Chromatography (IMAC)

  • For His-tagged protein, Ni-NTA or Co-NTA resins are the primary method

  • Buffer composition: Typically Tris or phosphate-based buffers (pH 7.5-8.0)

  • Imidazole gradient: Low concentration (10-20 mM) for binding, high concentration (250-300 mM) for elution

  • Addition of mild detergents may be necessary if membrane association causes aggregation

Secondary Purification: Size Exclusion Chromatography

  • Separates monomeric protein from aggregates

  • Provides information about oligomeric state

  • Buffer typically contains Tris/PBS with 6% Trehalose at pH 8.0

Quality Control Parameters:

  • Purity assessment: SDS-PAGE analysis, with commercial preparations typically ensuring >90% purity

  • Western blot confirmation using anti-His antibodies

  • Activity assays appropriate to the protein's function

After purification, the protein is typically prepared as a lyophilized powder for maximum stability during storage . This comprehensive purification approach ensures both high purity and preserved functional integrity of the recombinant protein.

What storage conditions maintain the stability of purified Glycine max CASP-like protein 12?

Maintaining stability of purified Glycine max CASP-like protein 12 requires careful attention to storage conditions. Based on established protocols, the following guidelines ensure optimal preservation of protein structure and function:

Recommended Storage Conditions:

Storage ParameterOptimal ConditionNotes
Physical FormLyophilized powderFor long-term storage
Storage Temperature-20°C/-80°CFor long-term preservation
Working Storage4°CFor up to one week
Buffer CompositionTris/PBS-based buffer with 6% Trehalose, pH 8.0Stabilizes protein structure
Cryoprotectant5-50% glycerol (final concentration)For frozen storage

Reconstitution Protocol:

  • Centrifuge vial briefly before opening to collect contents at bottom

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to desired final concentration (typically 50%) for long-term storage

  • Aliquot to avoid repeated freeze-thaw cycles

Critical Considerations:

  • Repeated freeze-thaw cycles significantly reduce protein stability and should be strictly avoided

  • Working aliquots should be prepared to minimize exposure to degradative conditions

  • For experiments requiring extended use, storage at 4°C is acceptable for up to one week

These storage guidelines maximize protein stability while maintaining accessibility for experimental applications.

What is the physiological role of CASP-like proteins in plant development?

CASP-like proteins play critical roles in plant development, particularly in establishing specialized membrane domains and modifying cell walls. While the specific function of Glycine max CASP-like protein 12 has not been directly characterized in the search results, research on related CASP proteins provides insights into their physiological significance:

Key Developmental Functions:

  • Membrane Domain Organization: CASP proteins form specialized membrane domains that serve as scaffolds for localized cell wall modification. This scaffold formation function can be separated from their role in cell wall modification, suggesting distinct molecular mechanisms .

  • Cell Wall Modification: Through interaction with secreted peroxidases, CASP proteins mediate the deposition of lignin and participate in building specialized structures like Casparian strips. These interactions are crucial for establishing proper cell wall architecture .

  • Barrier Formation: In Arabidopsis, CASP proteins are essential for forming Casparian strips in the root endodermis, which function as critical barriers controlling solute movement between soil and vascular tissues.

  • Targeted Localization: Studies show that CASP proteins exhibit highly specific localization patterns, with mutations in certain conserved residues affecting their proper positioning within the cell. For example, mutations in extracellular loop residues of Arabidopsis CASP1 (like W164G) dramatically impact its localization to specialized membrane domains .

The significance of these functions extends to multiple aspects of plant development, including root structure formation, nutrient uptake regulation, and potentially stress responses. In legumes like Glycine max, these proteins may have additional specialized functions related to nodulation or symbiotic relationships with soil microorganisms.

How do CASP-like proteins interact with the cell wall matrix?

CASP-like proteins interact with the cell wall matrix through multiple mechanisms, creating a functional continuum between the plasma membrane and cell wall. Based on studies of related proteins, the following interaction mechanisms likely apply to Glycine max CASP-like protein 12:

Primary Interaction Mechanisms:

  • Peroxidase Recruitment: CASP proteins interact with secreted peroxidases to mediate lignin deposition in the cell wall. This interaction is critical for building specialized structures like Casparian strips, but can also occur outside these domains when CASPs are ectopically expressed .

  • Domain Formation: CASPs create specialized membrane domains (CSDs) that juxtapose specific regions of the cell wall, allowing for localized modifications. This domain formation function appears to be independent from lignin deposition activities .

  • Two-Phase Process: Research indicates that CASP proteins first establish membrane domains, and subsequently direct cell wall modifications through enzyme recruitment. These activities can be uncoupled experimentally, indicating distinct molecular mechanisms .

  • Extracellular Loop Interactions: The extracellular loops of CASP proteins likely mediate interactions with cell wall components. In Arabidopsis CASP1, mutations in specific residues of extracellular loop 2 (EL2) affect protein localization, suggesting their importance in establishing proper membrane-wall contacts .

  • Conservation Patterns: The functional importance of these interactions is reflected in evolutionary conservation patterns, with certain residues in extracellular loops being highly conserved across species .

These interaction mechanisms collectively enable CASP proteins to serve as critical mediators between cellular membranes and the extracellular matrix, facilitating precise spatial control of cell wall modifications essential for plant development.

What experimental approaches can determine if Glycine max CASP-like protein 12 forms specialized membrane domains?

Determining whether Glycine max CASP-like protein 12 forms specialized membrane domains requires multiple complementary experimental approaches. Based on studies of related CASP proteins, the following methodological strategy is recommended:

Fluorescent Protein Fusion and Live Cell Imaging

  • Generate GFP/mCherry fusions of Glycine max CASP-like protein 12

  • Use confocal microscopy to observe localization patterns in plant cells

  • Time-lapse imaging to track domain formation dynamics

  • Compare wild-type protein localization with mutant variants affecting conserved residues

This approach parallels successful strategies used with Arabidopsis CASP1, where researchers used AtCASP1-GFP fusions to visualize domain formation and compare with AtCASP1-mCherry for co-localization studies .

Site-Directed Mutagenesis of Conserved Residues

  • Target conserved residues in extracellular loops based on homology with studied CASP proteins

  • Create mutations analogous to those that affected Arabidopsis CASP1 localization (e.g., equivalent to W164G, G158S, C168S)

  • Evaluate effects on membrane domain formation using fluorescence microscopy

Super-Resolution Microscopy

  • Techniques like STORM, PALM or STED microscopy to visualize membrane domains beyond diffraction limit

  • Quantify domain size, shape, and composition

Biochemical Membrane Fractionation

  • Isolate detergent-resistant membrane fractions

  • Analyze protein distribution across membrane fractions

  • Compare with known domain-forming proteins

Protein-Protein Interaction Analysis

  • Co-immunoprecipitation to identify interaction partners

  • Bimolecular fluorescence complementation (BiFC) to visualize interactions in planta

  • Focus on interactions with peroxidases, which are known partners of CASP proteins

This multi-faceted approach combines direct visualization with functional analysis, providing robust evidence for membrane domain formation and insights into the molecular mechanisms involved.

How do CASP-like proteins differ between Arabidopsis and Glycine max?

Comparing CASP-like proteins between Arabidopsis and Glycine max reveals important evolutionary adaptations while maintaining core functional elements. Although direct comparative data is limited in the search results, analysis of conservation patterns and structural features provides insights into their differences:

Sequence and Structural Differences:

  • Extracellular Loop Conservation: Studies of CASP proteins in Arabidopsis have identified critical extracellular loops, particularly EL1 and EL2, with specific conserved residues. The conservation pattern of these loops might differ in Glycine max, potentially reflecting adaptation to different root structures or environmental conditions .

  • Species-Specific Adaptations: Research on CASP homologs across plant species reveals interesting variation patterns. For example, while most plants show conservation in specific extracellular loop regions, some species like Utricularia gibba show clear divergence in these domains . Glycine max, as a legume, likely has specific adaptations related to its symbiotic relationships and root nodule formation.

  • Family Expansion: The CASP gene family has undergone expansion in different plant lineages, with some genomes containing over 20 CASP homologs . This expansion likely reflects functional diversification, with potentially different patterns between Arabidopsis and Glycine max.

Functional Implications:

  • Root Architecture Differences: Arabidopsis and Glycine max have substantially different root architectures, which may be reflected in specialization of their respective CASP proteins.

  • Nodulation Specialization: As a legume, Glycine max forms nitrogen-fixing root nodules, a process absent in Arabidopsis. CASP-like proteins in Glycine max might have specialized functions related to this symbiotic process.

  • Developmental Expression Patterns: The expression patterns and tissue specificity of CASP proteins likely differ between the two species, reflecting their distinct developmental programs.

These differences highlight the importance of species-specific studies rather than simple extrapolation from model plants to crops when investigating CASP protein function.

What evolutionary conservation patterns are observed in CASP-like proteins across plant species?

Evolutionary analysis of CASP-like proteins reveals complex conservation patterns that provide insights into their functional importance across plant species. The search results highlight several key evolutionary features:

Conservation Patterns in CASP Proteins:

This evolutionary analysis provides a foundation for understanding which protein domains are essential for core functions versus those that might confer species-specific adaptations, helping guide experimental designs for functional studies.

How can phylogenetic analysis inform functional studies of Glycine max CASP-like protein 12?

Phylogenetic analysis provides a powerful framework for guiding functional studies of Glycine max CASP-like protein 12 by revealing evolutionary relationships, functional constraints, and potential specializations. Researchers can leverage phylogenetic insights in several ways:

Strategic Applications of Phylogenetic Analysis:

  • Identification of Functional Domains:

    • Regions with high evolutionary conservation across diverse plant species likely represent functionally critical domains

    • Comparative analysis can identify residues under strong selective pressure

    • For example, studies of CASP proteins have shown that certain residues in extracellular loops are highly conserved and functionally important

  • Prediction of Specialized Functions:

    • Lineage-specific sequence innovations may indicate specialized functions

    • Glycine max-specific sequence features could be linked to legume-specific processes

    • Correlation with species that have similar root architecture or cell wall composition

  • Strategic Mutation Design:

    • Prioritize highly conserved residues for site-directed mutagenesis

    • Design experiments based on known effects of mutations in related proteins

    • For example, mutations analogous to those affecting Arabidopsis CASP1 localization (like W164G) could be targeted

  • Heterologous Expression Strategy:

    • Guide selection of appropriate experimental systems for functional complementation

    • Predict likelihood of functional conservation across species barriers

    • Determine appropriate positive controls from closely related proteins

  • Interpretation of Experimental Results:

    • Place functional findings in evolutionary context

    • Distinguish between ancestral functions and derived specializations

    • Understand how sequence divergence correlates with functional differences

  • Comparative Expression Analysis:

    • Correlate expression patterns with phylogenetic relationships

    • Identify conserved versus divergent regulatory mechanisms

By integrating phylogenetic analysis with experimental approaches, researchers can develop more targeted and informative studies of Glycine max CASP-like protein 12, efficiently exploring its functional roles while placing findings in a broader evolutionary context.

What protein-protein interaction methods are most suitable for studying CASP-like proteins?

Studying protein-protein interactions of CASP-like proteins requires specialized approaches due to their membrane localization and potential for forming multiprotein complexes. Based on current research methodologies, the following techniques are most suitable for investigating interactions of Glycine max CASP-like protein 12:

Optimized Interaction Detection Methods:

  • Co-immunoprecipitation with Membrane Protein Adaptations:

    • Use mild detergents (digitonin, DDM, or CHAPS) for membrane protein solubilization

    • Cross-linking prior to solubilization to capture transient interactions

    • Anti-His antibodies for tagged recombinant protein

    • Mass spectrometry analysis of co-precipitated proteins

  • Proximity-Based Labeling:

    • BioID or TurboID fusion constructs expressed in plant cells

    • Particularly valuable for capturing weak or transient interactions in native membrane environments

    • Can identify both direct binding partners and proteins in the same complex

  • Split-Ubiquitin Membrane Yeast Two-Hybrid:

    • Specifically designed for membrane protein interactions

    • Can screen libraries to identify novel interaction partners

    • Better suited than traditional Y2H for transmembrane proteins

  • Bimolecular Fluorescence Complementation (BiFC):

    • In planta visualization of protein interactions

    • Can verify interaction localization in membrane domains

    • Particularly useful for confirming peroxidase interactions, which are known partners of CASP proteins

  • Förster Resonance Energy Transfer (FRET):

    • Label-free detection of protein-protein interactions in living cells

    • Can provide spatial and temporal information about interactions

    • Useful for studying dynamic interactions during development

Based on studies of related CASP proteins, particular attention should be given to interactions with peroxidases, which are known to interact with CASP proteins to mediate lignin deposition and cell wall modification . This interaction represents a starting point for comprehensive interaction network analysis.

How can researchers investigate the role of Glycine max CASP-like protein 12 in stress responses?

Investigating the role of Glycine max CASP-like protein 12 in stress responses requires a multi-faceted experimental approach combining molecular, cellular, and whole-plant analyses. The following comprehensive methodology is recommended:

Experimental Strategy for Stress Response Analysis:

  • Expression Profiling Under Diverse Stresses:

    • qRT-PCR analysis across different stress conditions (drought, salinity, pathogen infection, etc.)

    • RNA-seq for genome-wide context of expression changes

    • Tissue-specific expression analysis focusing on roots, which are likely primary sites of action

    • Time-course studies to capture dynamic responses

  • Promoter Analysis and Regulation:

    • Promoter::GUS reporter constructs to visualize stress-responsive expression patterns

    • Identification of stress-responsive elements in the promoter region

    • Chromatin immunoprecipitation (ChIP) to identify transcription factors regulating expression under stress

  • Genetic Modification Approaches:

    • CRISPR/Cas9-mediated knockout or knockdown

    • Overexpression under constitutive or inducible promoters

    • Complementation experiments with wild-type or mutated versions

  • Subcellular Localization Under Stress:

    • Fluorescent protein fusions to track potential relocalization during stress

    • Co-localization with stress-induced membrane domains

    • Membrane fractionation to detect stress-induced changes in protein distribution

  • Protein Interaction Dynamics:

    • Co-immunoprecipitation under normal versus stress conditions

    • Identification of stress-specific interaction partners

    • Focus on interactions with peroxidases, which are known CASP protein partners involved in cell wall modification

  • Cell Wall Analysis:

    • Cell wall composition analysis under stress conditions in wild-type versus modified plants

    • Lignin quantification and distribution patterns

    • Cell wall integrity assays under stress conditions

  • Physiological Phenotyping:

    • Root growth and architecture under stress

    • Water relations and nutrient uptake efficiency

    • Stress tolerance assessment in modified versus control plants

This comprehensive approach will provide a detailed understanding of how Glycine max CASP-like protein 12 contributes to stress adaptation, particularly focusing on its potential roles in stress-induced cell wall modifications and membrane domain reorganization.

What are the most promising biotechnological applications of Glycine max CASP-like protein 12 research?

Research on Glycine max CASP-like protein 12 opens several promising biotechnological avenues with potential agricultural and industrial applications. Based on the functions of CASP-like proteins, the following areas represent the most promising biotechnological directions:

High-Potential Biotechnological Applications:

  • Enhanced Stress Tolerance in Crops:

    • Engineering CASP-like protein expression to improve drought, salinity, or pathogen resistance

    • Modifying cell wall properties through altered CASP activity to enhance barrier functions

    • Targeting specific stress-responsive elements in CASP gene promoters for precision stress response

  • Root Architecture Optimization:

    • Modulating CASP expression to influence root development patterns

    • Enhancing nutrient uptake efficiency through optimized barrier function

    • Tailoring root system architecture for specific soil conditions or agricultural practices

  • Cell Wall Engineering for Biofuel Production:

    • Altering lignin deposition patterns through CASP protein modification

    • Improving biomass digestibility for biofuel production

    • As CASP proteins interact with peroxidases to mediate lignin deposition , they represent key targets for biofuel crop improvement

  • Membrane Domain Engineering:

    • Developing synthetic biology approaches using CASP proteins as scaffolds

    • Creating novel membrane domains with specialized functions

    • Engineering new pathway compartmentalization strategies in plant cells

  • Protein Production Platform Development:

    • Optimizing recombinant protein expression systems based on insights from CASP protein studies

    • Improving purification protocols for membrane-associated proteins

    • Developing plant-based expression systems with enhanced production of target proteins

  • Specialized Biosensors:

    • Creating CASP-based biosensors for environmental monitoring

    • Developing systems to detect changes in plant-environment interactions

    • Engineering reporter systems for specific stresses or developmental stages

These applications leverage the fundamental roles of CASP proteins in membrane organization and cell wall modification, translating basic research insights into practical biotechnological innovations with potential agricultural, industrial, and environmental benefits.

What are the major unresolved questions in Glycine max CASP-like protein 12 research?

Despite advances in understanding CASP-like proteins, several critical questions remain unresolved regarding Glycine max CASP-like protein 12. These knowledge gaps represent important research priorities:

Key Unresolved Research Questions:

  • Precise Localization and Tissue Distribution:

    • What is the exact subcellular localization pattern of Glycine max CASP-like protein 12?

    • Does it form specialized membrane domains similar to Arabidopsis CASP proteins?

    • In which soybean tissues and developmental stages is it predominantly expressed?

  • Specific Cell Wall Modification Activity:

    • What specific cell wall components does it help modify?

    • Which peroxidases or other enzymes does it interact with in soybean?

    • How does its activity differ from other CASP-like proteins in the soybean genome?

  • Membrane Domain Formation Mechanisms:

    • What molecular mechanisms govern its assembly into specialized membrane domains?

    • Which protein regions are critical for domain formation versus enzymatic recruitment?

    • How is domain formation regulated during development or stress responses?

  • Legume-Specific Functions:

    • Does it play specialized roles in root nodule formation or symbiotic relationships?

    • How has its function diverged from non-legume CASP proteins?

    • Is it involved in specialized cell wall modifications unique to legumes?

  • Regulatory Networks:

    • What transcription factors control its expression?

    • How is its activity post-translationally regulated?

    • What signaling pathways modulate its function?

  • Structure-Function Relationships:

    • Which specific amino acids are critical for its various functions?

    • How do the extracellular loops contribute to its specific activities?

    • What is the three-dimensional structure of the protein in the membrane?

Addressing these questions will require integrated approaches combining advanced imaging, biochemical analysis, genetics, and comparative studies across plant species. Resolving these unknowns would significantly advance our understanding of plant cell wall biology and membrane organization with potential applications in crop improvement.

How can researchers overcome technical challenges in studying CASP-like membrane proteins?

Studying CASP-like membrane proteins presents significant technical challenges that require specialized approaches. Researchers can overcome these obstacles through the following methodological strategies:

Advanced Solutions for Technical Challenges:

  • Protein Expression and Purification Challenges:

    • Optimize expression using specialized E. coli strains designed for membrane proteins

    • Consider cell-free expression systems that bypass toxicity issues

    • Use fusion partners that enhance membrane protein solubility

    • Employ detergent screening to identify optimal solubilization conditions

    • Reconstitution into nanodiscs or liposomes for functional studies

  • Structural Analysis Limitations:

    • Combine computational prediction with experimental validation

    • Utilize cryo-electron microscopy for membrane protein structures

    • Apply site-directed spin labeling and EPR spectroscopy

    • Use hydrogen-deuterium exchange mass spectrometry for dynamics

    • Implement cross-linking mass spectrometry for interaction interfaces

  • In Vivo Imaging Constraints:

    • Apply super-resolution microscopy (PALM, STORM, STED) to visualize membrane domains

    • Use split fluorescent proteins for minimally disruptive tagging

    • Implement lattice light-sheet microscopy for long-term live imaging

    • Adopt expansion microscopy for enhanced resolution of membrane structures

    • Utilize correlative light and electron microscopy for ultrastructural context

  • Interaction Analysis Complexity:

    • Implement proximity labeling approaches (BioID, APEX)

    • Use membrane-specific two-hybrid systems (split-ubiquitin)

    • Apply chemical cross-linking prior to interaction analysis

    • Develop native membrane enrichment protocols

    • Utilize label-free protein interaction analysis methods

  • Genetic Manipulation Difficulties:

    • Optimize CRISPR/Cas9 delivery methods for soybean

    • Develop tissue-specific or inducible expression systems

    • Use hairy root transformation for rapid screening

    • Implement precision genome editing for subtle modifications

    • Develop multiplex editing approaches for family-wide functional analysis

By combining these advanced methodological approaches, researchers can overcome the inherent challenges of studying membrane proteins like Glycine max CASP-like protein 12, advancing our understanding of their complex biology and functional roles.

What integrative approaches will advance understanding of CASP-like protein function across plant species?

Advancing our understanding of CASP-like protein function requires integrative approaches that combine multiple disciplines and technologies. The following comprehensive strategy would significantly accelerate progress in this field:

Integrative Research Framework:

  • Multi-Omics Integration:

    • Combine transcriptomics, proteomics, metabolomics, and glycomics

    • Map species-specific expression patterns across developmental stages

    • Correlate with cell wall composition differences between species

    • Develop integrative computational models of CASP-like protein networks

  • Comparative Functional Genomics:

    • Systematic analysis across evolutionary diverse plant species

    • Parallel CRISPR-based knockouts in multiple plant systems

    • Cross-species complementation experiments

    • Correlation of functional differences with sequence divergence patterns

  • Advanced Imaging Networks:

    • Collaborative imaging platforms using consistent protocols

    • Standardized fluorescent tagging approaches across species

    • Multi-scale imaging from tissue to molecular level

    • Integration of functional imaging with structural analysis

  • Synthetic Biology Approaches:

    • Design chimeric CASP proteins with domains from different species

    • Create minimal synthetic CASP-like proteins with defined functions

    • Engineer novel membrane domains with tailored properties

    • Develop optogenetic tools to manipulate CASP function in real-time

  • Community-Wide Resources:

    • Develop comprehensive databases of CASP-like proteins across plant species

    • Establish repositories of validated constructs and expression systems

    • Create standardized protocols for membrane protein analysis

    • Share specialized tools for membrane domain visualization

  • Interdisciplinary Collaboration:

    • Bridge cell biology, biochemistry, genetics, and computational biology

    • Combine expertise in membrane biology and cell wall research

    • Integrate basic and applied research perspectives

    • Connect model system and crop research communities

This integrative approach would address the fundamental questions about how CASP-like proteins contribute to membrane organization and cell wall modification across plant species, while potentially revealing species-specific adaptations that could be harnessed for agricultural or biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.