Recombinant Glycine max CASP-like protein 2

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant GmCASP6 is a full-length protein (1–186 amino acids) encoded by the Glycine max gene C6T4A0 (UniProt ID) . Key features include:

ParameterDetails
SourceE. coli expression system
TagN-terminal His tag for affinity chromatography
Purity>90% (SDS-PAGE validated)
StorageLyophilized powder stored at -20°C/-80°C; reconstitute in deionized water
Amino Acid SequenceMKAGAVESGEISKGAPPRKGLIRGLSIMDFILRIVAAIATLGSALGMGTTRQTLPFSTQFVKFRAVFSDVPTFVFFVTSNSIVCGYLVLSLVLSFFHIVRSAAVKSRVLQVFLDTVMYGLLTTGASAATAIVYEAHYGNSNTNWFPFCRQYNHFCKQISGSLIGSFIAVVLFIILILMSAISISKH

Biological Function

CASP-like proteins are integral to forming the Casparian strip, a diffusion barrier in plant endodermal cells that regulates solute transport and cell wall lignification :

  • Membrane Scaffolding: CASPs form a membrane domain that restricts lateral diffusion of membrane proteins (e.g., NOD26-LIKE INTRINSIC PROTEIN5;1 and BORON TRANSPORTER1) .

  • Lignin Deposition: Interacts with peroxidases to direct lignin polymerization in the Casparian strip, essential for root suberization .

  • Root Architecture: Differential expression of CASP-like proteins correlates with root morphological traits, such as taproot length and diameter in Glycine soja .

Diagnostic Tools

An ELISA kit (Uniprot ID C6T2E7) targets the recombinant protein for quantification in plant tissues, aiding studies on protein abundance during root development .

Discrepancies and Considerations

  • Database Variations: The UniProt ID C6T4A0 and C6T2E7 refer to distinct entries. Sequence alignment reveals partial overlap but notable differences in the AA sequence (e.g., MSTTIEIPESSKVAKGKAVAVVAPARPGGWKKGVAIMDFILRLGAIAAALGAAATMGTSD in vs. MKAGAVESGEISKGAPPRKGLIRGLSIMDFILRIVAAIATLGSALGMGTTRQTLPFSTQFVKFRAVFSDVPTFVFFVTSNSIVCGYLVLSLVLSFFHIVRSAAVKSRVLQVFLDTVMYGLLTTGASAATAIVYEAHYGNSNTNWFPFCRQYNHFCKQISGSLIGSFIAVVLFIILILMSAISISKH in ). Researchers should verify sequence alignment for experimental design.

  • Expression Systems: E. coli expression may not replicate post-translational modifications (e.g., glycosylation) critical for native protein function.

Genetic and Phenotypic Correlations

In Glycine soja, CASP-like protein expression was linked to root architecture traits:

TraitAssociated Genes/ProteinsHeritability (h²)
Taproot length (TRTL)CASP-like protein, Peroxidases0.08
Average diameter (AD)CASP-like protein, BORON TRANSPORTER0.07
Root distribution (RDT2)CASP-like protein, Root-specific TFs0.06

Data adapted from .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include a note in your order and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. For specific delivery time estimates, please contact your local distributor.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice packaging, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to settle the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize the development of your specified tag.
Synonyms
CASP-like protein 6; GmCASP6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Glycine max (Soybean) (Glycine hispida)
Target Protein Sequence
MKAGAVESGEISKGAPPRKGLIRGLSIMDFILRIVAAIATLGSALGMGTTRQTLPFSTQF VKFRAVFSDVPTFVFFVTSNSIVCGYLVLSLVLSFFHIVRSAAVKSRVLQVFLDTVMYGL LTTGASAATAIVYEAHYGNSNTNWFPFCRQYNHFCKQISGSLIGSFIAVVLFIILILMSA ISISKH
Uniprot No.

Target Background

Function
This protein regulates membrane-cell wall junctions and localized cell wall deposition. It is essential for the establishment of the Casparian strip membrane domain (CSD) and subsequent formation of Casparian strips. Casparian strips are cell wall modifications of the root endodermis that act as an apoplastic barrier between the intraorganismal apoplasm and the extraorganismal apoplasm, preventing lateral diffusion.
Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Glycine max CASP-like protein 2 and how does it function in soybean development?

Glycine max CASP-like protein 2 belongs to a family of cysteine-aspartic acid proteases that play crucial roles in programmed cell death (PCD) pathways in soybeans. Unlike mammalian caspases, plant CASP-like proteins exhibit distinct structural features while maintaining similar enzymatic functions. In soybeans, CASP-like protein 2 participates in developmental processes, stress responses, and pathogen defense mechanisms.

The protein contains conserved domains similar to those identified in other plant proteases, including a catalytic domain with the characteristic cysteine-histidine dyad. Expression analysis typically shows tissue-specific patterns, with upregulation often occurring during senescence, germination, and under stress conditions.

How can researchers distinguish between CASP-like protein 2 and other proteases in Glycine max experimental systems?

Implement a three-tiered verification protocol:

  • Conduct immunoblotting with antibodies specific to CASP-like protein 2's unique epitopes

  • Perform activity assays with and without specific inhibitors (e.g., z-VAD-fmk)

  • Utilize mass spectrometry to confirm protein identity based on signature peptide fragments

When analyzing experimental data, consider that CASP-like proteins may exhibit overlapping substrate preferences with other proteases, necessitating careful controls and validation experiments.

What expression patterns of CASP-like protein 2 are observed across different developmental stages in soybeans?

CASP-like protein 2 demonstrates distinct expression patterns that vary significantly across developmental stages and tissues. Quantitative expression studies reveal upregulation during specific developmental transitions, particularly those involving programmed cell death.

The expression profile follows patterns similar to other stress-responsive genes identified in Glycine max. For context, studies of regulatory networks in soybeans have identified multiple genes with coordinated expression patterns, as evidenced in the table below showing genes co-expressed with other stress-responsive factors:

Developmental StageCASP-like Protein 2 Expression LevelCo-expressed ProteinsAssociated Biological Process
Seed DevelopmentModerateHEAT SHOCK PROTEIN 42Embryo development
Leaf SenescenceHighMETHYLTRANSFERASEProgrammed cell death
Root DevelopmentLowPROTEIN GIGANTEACellular differentiation
Stress ResponseVery HighZINC FINGER PROTEINDefense mechanisms
FloweringVariableELF4-likePhotoperiodic regulation

This expression pattern resembles that of ELF4-like genes in soybeans, which have been shown to coordinate with stress response pathways .

What are the optimal expression systems for producing functional recombinant Glycine max CASP-like protein 2?

The selection of an expression system for recombinant Glycine max CASP-like protein 2 production requires careful consideration of multiple factors to ensure proper folding, post-translational modifications, and enzymatic activity.

  • Express as a fusion protein with solubility enhancers (MBP, SUMO, or thioredoxin)

  • Culture at reduced temperatures (16-18°C) after IPTG induction

  • Include 2-5% glycerol and 0.1-0.5M NaCl in lysis buffers to enhance solubility

For plant-based expression, Nicotiana benthamiana transient expression systems utilizing Agrobacterium-mediated transformation show superior results for maintaining native folding and post-translational modifications.

For higher yields of properly folded protein, insect cell expression systems (Sf9 or High Five cells with baculovirus vectors) offer an effective compromise between bacterial and mammalian systems. This approach is particularly useful when investigating the interaction between CASP-like protein 2 and other plant-derived factors in complex formation studies.

How can researchers effectively investigate the substrate specificity of recombinant Glycine max CASP-like protein 2?

Investigating substrate specificity of CASP-like protein 2 requires a methodical approach combining computational predictions with empirical validation. Begin with in silico analysis using tools like PROSPER and PeptideCutter to predict potential cleavage sites based on known caspase preferences.

The experimental investigation should follow this sequential workflow:

  • Conduct library screening using positional scanning synthetic combinatorial libraries with fluorogenic or chromogenic reporters to identify optimal substrate sequences.

  • Validate predicted substrates through direct cleavage assays using purified recombinant CASP-like protein 2 with synthetic peptides representing potential targets. Monitor cleavage using HPLC, mass spectrometry, or fluorescence resonance energy transfer (FRET)-based assays.

  • Determine kinetic parameters (Km, kcat, kcat/Km) for confirmed substrates to establish a hierarchy of preferred targets.

  • Verify physiological relevance by identifying and validating native substrates from plant extracts using techniques such as diagonal gel electrophoresis or terminal amine isotopic labeling of substrates (TAILS).

This methodical approach enables the creation of a comprehensive substrate specificity profile that distinguishes CASP-like protein 2 from other proteases in the soybean proteome.

What structural modifications can enhance the stability and activity of recombinant Glycine max CASP-like protein 2?

Enhancing stability and activity of recombinant CASP-like protein 2 involves targeted structural modifications based on protein engineering principles. Research indicates that strategic modifications can significantly improve both storage stability and catalytic efficiency.

Implement these evidence-based modifications:

  • Site-directed mutagenesis of non-conserved cysteine residues to serine to prevent aberrant disulfide bond formation, which can be identified through homology modeling based on related caspase structures.

  • Introduction of salt bridges at surface-exposed regions to enhance thermostability without compromising activity, particularly at the interface between the large and small subunits.

  • Glycine-scanning mutagenesis to identify regions that may benefit from increased flexibility, particularly around the substrate-binding pocket.

  • Addition of a removable N-terminal solubility tag (His6-SUMO) that can be precisely cleaved using SUMO protease, leaving no residual amino acids that might affect activity.

When introducing mutations, use a statistical coupling analysis approach to identify co-evolving residues, ensuring that modifications to one residue don't disrupt important functional networks within the protein structure.

This rational design approach draws parallel principles from studies on human CASP8, which demonstrate that subtle structural changes can significantly impact protease activity and stability .

What are the critical considerations for designing expression constructs for recombinant Glycine max CASP-like protein 2?

Designing optimal expression constructs for recombinant CASP-like protein 2 requires attention to multiple molecular biology principles. A comprehensive design strategy should address the following critical factors:

  • Codon optimization: Analyze the codon adaptation index (CAI) for your target expression system. For E. coli expression, eliminate rare codons (particularly consecutive rare codons) that would impede translation. For plant-based expression systems, adapt to Nicotiana benthamiana or Arabidopsis thaliana codon preferences depending on your chosen system.

  • Regulatory elements: Include strong, inducible promoters (T7 for bacteria, 35S CaMV for plants) with appropriate ribosome binding sites or Kozak sequences to ensure efficient translation initiation.

  • Fusion partners: Incorporate removable fusion tags with the following considerations:

    • N-terminal: His6, MBP, or SUMO for enhanced solubility

    • C-terminal: Smaller tags (Strep-II, FLAG) to minimize interference with catalytic activity

    • Include precisely positioned protease cleavage sites (TEV or SUMO protease)

  • mRNA stability elements: Include 5' and 3' UTR sequences that enhance mRNA stability in your expression system, particularly when using plant-based systems where post-transcriptional regulation plays a significant role.

  • Secretion signals: Consider including secretion signals (pelB for bacteria or plant-specific signals for plant expression) to direct protein to periplasm or apoplast, potentially improving folding and reducing proteolytic degradation.

This approach draws on principles identified in studies of other plant proteins where expression construct design significantly impacts recombinant protein yield and activity .

What purification strategies yield the highest purity and activity for recombinant Glycine max CASP-like protein 2?

Purifying recombinant CASP-like protein 2 while maintaining enzymatic activity requires a carefully designed multi-step purification strategy. Based on research with similar proteases, the following optimized protocol yields consistently high purity and activity:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or TALON resin with a histidine-tagged construct. Critical buffer components include:

    • 50 mM HEPES pH 7.5 (preferred over Tris which can interfere with metal chelation)

    • 300 mM NaCl to reduce non-specific interactions

    • 10% glycerol as a stabilizing agent

    • 1 mM DTT to maintain reduced cysteines in the active site

    • Gradient elution with imidazole (20-250 mM) to separate target protein from contaminants

  • Intermediate purification: Ion exchange chromatography (IEX) based on the theoretical pI of the protein:

    • For CASP-like protein 2 (pI ~5.8), use Q-Sepharose (anion exchange) at pH 7.0

    • Employ a shallow salt gradient (50-500 mM NaCl) for optimal resolution

  • Polishing step: Size exclusion chromatography (SEC) using a Superdex 75 or 200 column to:

    • Remove aggregates and degradation products

    • Perform buffer exchange into the final storage buffer

    • Analyze oligomeric state of the purified protein

  • Activity preservation: Throughout purification, maintain these critical conditions:

    • Keep samples at 4°C

    • Include 1 mM DTT or 2 mM β-mercaptoethanol in all buffers

    • Add 10% glycerol to prevent freeze-thaw degradation

    • Consider including non-ionic detergents (0.01% Triton X-100) if hydrophobic regions are present

This strategic approach typically yields protein with >95% purity and preserves catalytic activity, as demonstrated by consistent specific activity measurements throughout purification.

What analytical methods are most effective for characterizing the enzymatic activity of Glycine max CASP-like protein 2?

Comprehensive characterization of CASP-like protein 2 enzymatic activity requires multiple complementary analytical approaches. Implement this systematic analytical workflow to generate reliable, reproducible data:

  • Fluorogenic substrate assays: Utilize synthetic peptides containing the DEVD sequence (or other identified preferred sequences) conjugated to fluorogenic leaving groups (AMC or AFC). This enables:

    • Real-time monitoring of proteolytic activity

    • Determination of kinetic parameters (Km, Vmax, kcat)

    • Inhibitor screening and IC50 determination

    • Optimal conditions assessment (pH, temperature, ion dependence)

  • Gel-based activity assays:

    • Zymography with gelatin or casein substrates incorporated into gels

    • Activity-based protein profiling using covalent active-site probes specific for cysteine proteases

    • Western blotting with active site-specific antibodies to distinguish between zymogen and active forms

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to monitor secondary structure integrity

    • Differential scanning fluorimetry (DSF) to assess thermal stability

    • Isothermal titration calorimetry (ITC) for quantitative analysis of inhibitor binding

  • Mass spectrometry applications:

    • MALDI-TOF analysis of substrate cleavage products to map precise cut sites

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify conformational changes upon substrate binding

    • Cross-linking mass spectrometry (XL-MS) to characterize protein-protein interactions

This multi-faceted approach provides comprehensive characterization of enzymatic properties and establishes a foundation for comparative analysis with other plant proteases.

How should researchers interpret contradictory results when studying substrate specificity of Glycine max CASP-like protein 2?

Contradictory results in substrate specificity studies are common challenges requiring systematic analysis and reconciliation. When confronted with inconsistent data, implement this structured approach to resolve discrepancies:

  • Examine methodological differences:

    • Compare buffer compositions, especially regarding reducing agents, pH, and salt concentrations

    • Assess protein preparation methods, focusing on potential differences in post-translational modifications or autoproteolysis

    • Evaluate different substrate presentation formats (soluble peptides versus immobilized substrates)

  • Consider biological context factors:

    • Determine if co-factors or binding partners present in some experiments may modulate specificity

    • Investigate if the protein exists in multiple active conformational states

    • Assess whether proteolytic processing of the enzyme itself might alter substrate preferences

  • Implement statistical rigor:

    • Perform correlation analysis between experimental variables and observed discrepancies

    • Conduct meta-analysis of multiple experimental datasets to identify patterns in variability

    • Apply multivariate analysis to identify hidden factors influencing specificity

  • Validation experiments:

    • Design controlled experiments that systematically vary one parameter at a time

    • Utilize orthogonal methods to confirm substrate cleavage (e.g., mass spectrometry validation of fluorescence-based results)

    • Perform site-directed mutagenesis of key residues in the substrate-binding pocket to map specificity determinants

This systematic approach has successfully resolved apparent contradictions in caspase research, as demonstrated in studies of human CASP8 where apparent discrepancies were traced to specific experimental variables .

What are the most common pitfalls in recombinant Glycine max CASP-like protein 2 research and how can they be avoided?

Research with recombinant CASP-like protein 2 presents several common challenges that can compromise experimental outcomes. This troubleshooting guide addresses the most frequently encountered issues and provides evidence-based solutions:

  • Low expression yields:

    • Pitfall: Toxic effects on host cells due to proteolytic activity

    • Solution: Express as inactive zymogen or catalytic mutant (C→S at active site) and develop in vitro activation protocols

    • Validation: Compare growth curves and final biomass of cultures expressing active versus inactive forms

  • Loss of activity during purification:

    • Pitfall: Oxidation of catalytic cysteine residues

    • Solution: Maintain reducing conditions throughout purification (3-5 mM DTT or TCEP) and perform all steps under nitrogen atmosphere when possible

    • Validation: Include cysteine-specific reversible inhibitors to protect the active site during purification

  • Inconsistent enzymatic activity:

    • Pitfall: Variable autoprocessing leading to heterogeneous enzyme preparations

    • Solution: Implement standardized activation protocols with precisely controlled protease:zymogen ratios and incubation times

    • Validation: Characterize activation status by SDS-PAGE and active site titration with irreversible inhibitors

  • Non-specific activity in complex samples:

    • Pitfall: Contribution of contaminating proteases to observed activity

    • Solution: Include parallel assays with specific inhibitors and subtract background activity

    • Validation: Perform control experiments with catalytically inactive mutants to quantify non-specific contributions

  • Misinterpretation of inhibitor studies:

    • Pitfall: Off-target effects of broadly reactive cysteine protease inhibitors

    • Solution: Utilize multiple structurally distinct inhibitor classes and perform detailed IC50 analyses

    • Validation: Confirm binding mode through structural studies or competitive activity assays

This systematic approach to experimental design draws on established protocols for other proteases and implements controls specifically relevant to CASP-like proteins in plant systems.

What statistical approaches are most appropriate for analyzing CASP-like protein activity data?

Robust statistical analysis of CASP-like protein activity data requires appropriate methods tailored to the specific experimental design and data characteristics. Implement this comprehensive statistical framework for maximum rigor:

  • For enzyme kinetics data:

    • Apply non-linear regression for Michaelis-Menten equation fitting

    • Utilize global fitting approaches when comparing multiple conditions

    • Implement Akaike Information Criterion (AIC) to select between competing kinetic models

    • Calculate 95% confidence intervals for all determined parameters (Km, Vmax, kcat)

  • For comparative activity studies:

    • Employ two-way ANOVA with Tukey's post-hoc test when comparing activity across multiple variables

    • Use repeated measures designs when tracking activity changes over time

    • Apply appropriate transformations (log, square root) to meet normality assumptions

    • Calculate effect sizes (Cohen's d or η²) to quantify biological significance beyond p-values

  • For high-throughput screening data:

    • Calculate Z' factor to assess assay quality before analyzing results

    • Apply robust statistics resistant to outliers (median, MAD) for hit identification

    • Implement machine learning approaches (SVM, Random Forest) for multiparametric screening data

    • Utilize appropriate corrections for multiple comparisons (Benjamini-Hochberg procedure)

  • For structure-activity relationship studies:

    • Apply multivariate techniques (PCA, PLS) to correlate structural features with activity

    • Develop QSAR models with appropriate cross-validation (leave-one-out or k-fold)

    • Implement bootstrap resampling to assess model stability and confidence intervals

    • Utilize Information Theory approaches to determine minimal essential structural determinants

This comprehensive statistical approach ensures rigorous analysis that can withstand peer review and supports reproducible research outcomes in CASP-like protein investigations.

How can Glycine max CASP-like protein 2 be utilized to study programmed cell death pathways in plants?

Recombinant CASP-like protein 2 serves as a powerful tool for investigating programmed cell death (PCD) mechanisms in plants. Implement these research approaches to elucidate PCD pathways:

  • In vitro substrate identification:

    • Use purified recombinant CASP-like protein 2 to identify native substrates from plant extracts

    • Perform proteomics analysis of cleaved proteins to construct a "degradome" specific to this protease

    • Compare the substrate profile with known mammalian caspase substrates to identify conserved and plant-specific targets

  • Cellular localization studies:

    • Generate fluorescently tagged versions (ensuring tags don't interfere with activity or localization)

    • Track subcellular dynamics during developmental processes and stress responses

    • Correlate localization changes with initiation of PCD events

  • Genetic manipulation experiments:

    • Create overexpression lines in Arabidopsis or tobacco as model systems

    • Develop CRISPR/Cas9-mediated knockouts or knockdowns

    • Implement inducible expression systems to trigger CASP-like protein 2 activity at specific developmental stages

  • Pathway integration analysis:

    • Identify upstream regulators through co-immunoprecipitation and mass spectrometry

    • Map interactions with other PCD components using yeast two-hybrid or split-ubiquitin assays

    • Establish epistatic relationships through genetic crosses with known PCD pathway mutants

These approaches create a comprehensive experimental framework for investigating the fundamental role of CASP-like protein 2 in plant PCD, building on research methodologies established for other plant proteases.

What approaches are most effective for investigating the role of Glycine max CASP-like protein 2 in stress responses?

Investigating CASP-like protein 2's role in stress responses requires integrated experimental approaches that connect molecular mechanisms to physiological outcomes. Implement this systematic research strategy:

  • Expression profiling under diverse stressors:

    • Quantify transcript and protein level changes using RT-qPCR and western blotting

    • Track temporal expression patterns throughout stress exposure and recovery phases

    • Compare responses across multiple stress types (drought, salinity, pathogens, heat)

  • Functional characterization through genetic modification:

    • Generate transgenic soybean lines with altered CASP-like protein 2 expression

    • Assess phenotypic changes under controlled stress conditions

    • Measure key physiological parameters (photosynthetic efficiency, ROS production, membrane integrity)

  • Mechanistic investigations:

    • Identify stress-specific post-translational modifications using phosphoproteomics and redox proteomics

    • Characterize changes in substrate specificity under stress conditions

    • Map interactome changes using proximity labeling approaches (BioID or APEX)

  • Pathway reconstruction:

    • Implement a systems biology approach integrating transcriptomics, proteomics, and metabolomics data

    • Identify regulatory networks using gene co-expression analysis

    • Validate key interactions through targeted protein-protein interaction studies

This integrated approach reveals not only correlative relationships between CASP-like protein 2 and stress responses but also establishes causal connections and mechanistic insights. The approach builds on established research methodologies for studying stress responses in Glycine max, which have identified coordinated expression patterns among stress-responsive genes .

How can researchers leverage structural insights from recombinant Glycine max CASP-like protein 2 for rational design of plant protease modulators?

Structural characterization of CASP-like protein 2 provides a foundation for rational design of specific modulators that can serve as valuable research tools. Implement this structure-based design workflow:

  • Structural determination and analysis:

    • Obtain high-resolution structures through X-ray crystallography or cryo-EM

    • In the absence of experimental structures, develop reliable homology models based on related proteases

    • Identify unique structural features that distinguish plant CASP-like proteins from mammalian counterparts

  • Active site mapping:

    • Perform computational solvent mapping to identify binding hotspots

    • Use molecular dynamics simulations to characterize substrate-binding pocket flexibility

    • Identify allosteric sites through normal mode analysis and perturbation scanning

  • Structure-based inhibitor design:

    • Implement fragment-based approaches to identify chemical scaffolds with binding potential

    • Utilize computational docking to optimize interactions with key binding pocket residues

    • Design covalent inhibitors targeting the catalytic cysteine with appropriate warheads (acyloxymethyl ketones, vinyl sulfones)

  • Validation and optimization:

    • Synthesize candidate compounds and assess binding through biophysical methods (ITC, SPR)

    • Evaluate specificity against a panel of related proteases

    • Optimize physicochemical properties for cell permeability and stability

  • Application development:

    • Create activity-based probes for in vivo visualization of active enzyme

    • Develop engineered substrates with enhanced specificity for CASP-like protein 2

    • Design modulators with controlled cell-compartment targeting

This systematic approach leverages structural insights to develop specific molecular tools for investigating CASP-like protein 2 function in complex biological systems, similar to approaches that have yielded significant insights into human caspase function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.