Recombinant Glycine max CASP-like protein 5

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

UniProt ID: C6SZP8
Synonyms: CASP-like protein 1E2, GmCASPL1E2
Gene Name: Glycine max CASP-like protein 5

PropertyDetails
Protein LengthPartial (CSB-EP510495GGV1 ) or Full-Length (1-187aa, RFL19325GF )
TagN-terminal His tag
Expression SystemE. coli
Purity>85% (SDS-PAGE ) or >90% (SDS-PAGE )

Expression and Purification

  • Produced in E. coli with tris/PBS-based buffer and 6% trehalose (pH 8.0) .

  • Lyophilized powder form recommended for long-term storage .

Reconstitution Guidelines

  • Centrifuge vial before reconstitution in sterile water (0.1–1.0 mg/mL) .

  • Add 5–50% glycerol for aliquoting; default is 50% .

Functional Role in Plant Biology

CASP-like proteins are four-transmembrane domain proteins that form the Casparian strip membrane domain (CSD) in endodermal cells. This domain acts as a diffusion barrier, restricting apoplastic flow and maintaining ion homeostasis . Key findings include:

  • Localization: CASP proteins stabilize membrane domains, preventing lateral diffusion of lipids and proteins like NOD26-LIKE INTRINSIC PROTEIN5;1 .

  • Evolutionary Conservation: CASP homologs in Glycine max suggest conserved roles in root endodermal development .

Functional Assays

  • Used to study CSD assembly and its role in nutrient transport .

  • Reconstituted in liposomes to test barrier properties .

Comparative Analysis of Available Variants

Product CodeLengthTagPuritySource
CSB-EP510495GGV1 PartialHis>85%Cusabio
RFL19325GF Full-LengthHis>90%CreativeBio

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference for your reconstitution.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us. We will prioritize developing the specified tag whenever possible.
Synonyms
CASP-like protein 1E2; GmCASPL1E2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Glycine max (Soybean) (Glycine hispida)
Target Protein Sequence
MEGVESKEREVMVAKPVAVGVSDLLLRLLAFTVTLVAAIVIAVDKQTKVVPIQLSDSLPP LDVPLTAKWHQMSAIVYFLVTNAIACTYAVLSLLLALVNRGKSKGLWTLIAVLDAFMVAL LFSGNGAAAAVGVLGYKGNSHVNWNKVCNVFGKFCDQMAASIGVSLIGSLAFLLLVIIPG VRLHRRN
Uniprot No.

Target Background

Database Links

KEGG: gmx:100500041

UniGene: Gma.55769

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of Glycine max CASP-like protein 5?

Glycine max CASP-like protein 5 belongs to the CASP-like protein family, which consists of four-transmembrane span proteins. Similar to other CASP proteins, it likely contains two extracellular loops (EL1 and EL2) and cytoplasmic N and C termini. The protein is expected to have a structure similar to CASP-like protein 7, which is 193 amino acids in length . The transmembrane domains are highly conserved among CASP-like proteins and play a crucial role in membrane localization and scaffold formation .

What are the primary functions of CASP-like proteins in Glycine max?

CASP-like proteins in plants, including Glycine max, are believed to function in forming membrane domains and mediating local cell wall modifications. Based on research on related CASP proteins, they likely function as membrane scaffolds that can recruit cell wall modification enzymes to specific locations . In the endodermis of roots, CASP proteins facilitate the formation of Casparian strips by interacting with peroxidases to mediate lignin deposition. CASP-like protein 5 in soybean may have similar or specialized functions in generating plasma membrane domains and directing cell wall modifications in specific tissues .

How does Glycine max CASP-like protein 5 relate to other members of the CASP protein family?

Glycine max CASP-like protein 5 is part of a larger CASPL (CASP-like) protein family found throughout the plant kingdom. Phylogenetic analysis has shown that CASP-like proteins are present in all major divisions of land plants and even in green algae . The CASPL family shares structural similarities with the MARVEL protein family found outside the plant kingdom. Within soybean, multiple CASP-like proteins exist, with varying degrees of sequence conservation, particularly in the transmembrane domains. The specific evolutionary relationship between CASP-like protein 5 and other family members would depend on sequence conservation in critical regions such as the extracellular loops and transmembrane domains .

What expression systems are most effective for producing recombinant Glycine max CASP-like protein 5?

E. coli is the most commonly used expression system for recombinant CASP-like proteins from Glycine max, as evidenced by successful expression of CASP-like protein 7 . When expressing transmembrane proteins like CASP-like protein 5, several considerations are essential:

  • Codon optimization for E. coli expression

  • Selection of appropriate fusion tags (His-tag is commonly used)

  • Optimization of induction conditions (temperature, IPTG concentration)

  • Use of specialized E. coli strains designed for membrane protein expression

For more complex studies requiring post-translational modifications, eukaryotic expression systems such as insect cells or yeast might be considered, though this would require significant protocol optimization.

What purification strategy should be employed for isolating Glycine max CASP-like protein 5?

For His-tagged recombinant Glycine max CASP-like protein 5, a multi-step purification approach is recommended:

  • Cell lysis using appropriate detergents to solubilize membrane proteins

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Size exclusion chromatography to enhance purity

  • Optional ion-exchange chromatography as a polishing step

The choice of detergents is critical for maintaining protein structure and function. Common detergents for membrane protein purification include n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin. The purified protein should be assessed for purity via SDS-PAGE, with expected purity greater than 90% .

What are the optimal storage conditions for maintaining activity of recombinant Glycine max CASP-like protein 5?

Based on documented storage requirements for CASP-like protein 7, the following conditions are recommended :

Storage ConditionTemperatureDurationNotes
Short-term4°CUp to 1 weekFor working aliquots
Medium-term-20°CUp to 6 monthsFor liquid form
Long-term-80°C12+ monthsFor lyophilized form

Repeated freeze-thaw cycles should be avoided as they may compromise protein integrity and function . For extended storage, addition of glycerol (final concentration 5-50%) is recommended before aliquoting and freezing. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

How can I design experiments to investigate membrane localization of Glycine max CASP-like protein 5?

To investigate membrane localization of CASP-like protein 5, consider the following experimental approach:

  • Generate fluorescent protein fusions (GFP or mCherry) at either the N- or C-terminus

  • Express the fusion protein in appropriate plant systems:

    • Heterologous expression in Arabidopsis endodermal cells

    • Homologous expression in soybean tissues under native or constitutive promoters

  • Perform confocal microscopy to track localization patterns

  • Use co-localization studies with known membrane domain markers

  • Conduct time-course studies to observe dynamics of protein localization

For mutagenesis studies investigating localization determinants, focus on conserved residues in transmembrane domains and extracellular loops. Based on research on related proteins, the second extracellular loop (EL2) contains residues critical for proper localization, particularly tryptophan and cysteine residues (e.g., W164, C168, and C175 in CASP1) .

What approaches can be used to study protein-protein interactions involving CASP-like protein 5?

Several complementary techniques can be employed to investigate protein-protein interactions:

  • Yeast two-hybrid screening - Useful for initial identification of potential interacting partners

  • Co-immunoprecipitation (Co-IP) - Confirms interactions in native or near-native conditions

  • Bimolecular Fluorescence Complementation (BiFC) - Visualizes interactions in plant cells

  • Förster Resonance Energy Transfer (FRET) - Measures proximity between tagged proteins

  • Proximity-dependent biotin identification (BioID) - Identifies proteins in close proximity

When designing these experiments, consider that CASP proteins interact with cell wall modification enzymes such as peroxidases . Cross-linking studies prior to Co-IP may be necessary to capture transient interactions. For transmembrane proteins like CASP-like protein 5, membrane solubilization conditions must be carefully optimized to maintain protein interactions.

What cell wall analysis methods are appropriate when studying the function of CASP-like protein 5?

To assess the potential role of CASP-like protein 5 in cell wall modification:

These methods should be applied to transgenic plants with altered CASP-like protein 5 expression or to specific tissues where the protein is normally expressed to determine its influence on cell wall composition and structure.

How can CRISPR/Cas9 technology be utilized to study CASP-like protein 5 function in Glycine max?

CRISPR/Cas9 offers powerful approaches for studying CASP-like protein 5 function in soybean:

  • Gene knockout studies:

    • Design sgRNAs targeting coding regions to generate null alleles

    • Create multiplex knockouts of related CASP-like genes to address functional redundancy

  • Promoter editing:

    • Target regulatory elements to modulate gene expression

    • Remove transcriptional repressor binding sites to enhance expression, similar to approaches used for NF-YC4 in soybean

  • Domain-specific modifications:

    • Introduce precise mutations in functional domains to assess their importance

    • Create specific deletions of extracellular loops to determine their role in localization and function

  • Tagging endogenous loci:

    • Integrate fluorescent tags or epitope tags at the genomic locus for tracking the native protein

For soybean transformation, Agrobacterium-mediated methods using cotyledonary node explants are most effective, with selection using appropriate markers. The edited plants should be thoroughly genotyped and phenotyped for cell wall composition, tissue architecture, and stress responses .

What structural analysis approaches can resolve the membrane topology of CASP-like protein 5?

Resolving membrane protein structure requires specialized techniques:

  • Computational prediction:

    • Use hydropathy analysis and transmembrane domain prediction algorithms

    • Apply homology modeling based on related proteins with known structures

  • Experimental topology mapping:

    • Protease protection assays with epitope-tagged versions

    • Glycosylation mapping using inserted glycosylation sites

    • Cysteine scanning mutagenesis with membrane-impermeable reagents

  • Advanced structural techniques:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy for high-resolution structure

    • Solid-state NMR spectroscopy for specific structural elements

  • Dynamic structural analysis:

    • Molecular dynamics simulations to predict behavior in membrane environments

    • Hydrogen-deuterium exchange mass spectrometry to identify exposed regions

When designing constructs for structural studies, consider removing flexible regions that may hinder crystallization while preserving core functional domains.

How does post-translational modification affect CASP-like protein 5 function and localization?

Post-translational modifications (PTMs) likely play critical roles in regulating CASP-like protein 5:

  • Identification of PTMs:

    • Mass spectrometry of purified protein to identify modifications

    • Phospho-specific antibodies if phosphorylation is suspected

    • Site-directed mutagenesis of potential modification sites

  • Functional impact analysis:

    • Create phosphomimetic mutations (S/T to D/E) or phospho-null mutations (S/T to A)

    • Analyze changes in protein localization using fluorescent fusions

    • Assess impact on protein-protein interactions and membrane domain formation

  • Temporal regulation:

    • Investigate PTM changes during development or stress responses

    • Use phosphatase or kinase inhibitors to manipulate modification status

PTMs may regulate the timing of CASP-like protein incorporation into membrane domains or modulate interactions with cell wall modification enzymes, similar to regulatory mechanisms in other membrane proteins.

How does CASP-like protein 5 in Glycine max compare to homologs in other plant species?

Comparative analysis reveals evolutionary insights into CASP-like protein function:

SpeciesCharacteristics of CASP-like ProteinsNotable Differences
Arabidopsis thalianaWell-characterized CASP1-5 in endodermisSpecific EL1 signature in true CASPs
Oryza sativa (rice)Multiple CASP homologsVariation in expression patterns
Glycine max (soybean)Expanded CASPL familyPossible specialization for legume-specific processes
Utricularia gibbaMultiple CASPLs but divergent EL1 sequenceLacks true roots and typical Casparian strips
Green algaePrimitive CASPL homologsLack specialized features of land plant CASPs

The EL1 signature appears to be a distinguishing feature of true CASPs versus CASPLs, with specific conservation patterns that correlate with the ability to form Casparian strips . Comparative genomic analysis indicates that CASP-like proteins diversified during plant evolution, with expanded families in species like soybean that underwent genome duplication events.

What functional domains differentiate CASP-like protein 5 from other members of the CASP family?

Key functional domains and their distinctive features include:

  • Transmembrane domains:

    • Highly conserved across CASP and CASPL proteins

    • Critical for membrane integration and scaffold formation

  • First extracellular loop (EL1):

    • Contains diagnostic signature sequence in true CASPs

    • May determine functional specialization

  • Second extracellular loop (EL2):

    • Contains conserved residues (including W164, C168, F174, C175 in CASP1) important for localization

    • Variations may determine tissue-specific functions

  • Cytoplasmic regions:

    • May mediate interactions with cytosolic proteins

    • Potential sites for regulatory modifications

The specific combination of these domains and their sequence variations likely determines the functional specificity of CASP-like protein 5 compared to other family members. Detailed sequence analysis and domain swapping experiments would help identify the unique characteristics of this specific protein.

How can phylogenetic analysis inform functional predictions for CASP-like protein 5?

Phylogenetic analysis provides a framework for functional predictions:

  • Clade identification:

    • Determine which subgroup of the CASPL family contains protein 5

    • Assess proximity to functionally characterized members

  • Conservation pattern analysis:

    • Identify residues under positive or purifying selection

    • Map conservation onto structural models to identify functional hotspots

  • Expression correlation studies:

    • Compare expression patterns of closely related CASPLs

    • Identify co-expressed genes that may function in the same pathway

  • Synteny analysis:

    • Examine genomic context of CASPL genes across species

    • Identify conserved gene clusters that suggest functional relationships

Functional predictions based on phylogeny should be validated through experimental approaches such as complementation studies, where CASP-like protein 5 is expressed in mutants of related CASP genes to assess functional equivalence.

What are common challenges in expressing and purifying Glycine max CASP-like protein 5?

Researchers should anticipate several challenges when working with this transmembrane protein:

  • Expression obstacles:

    • Low expression levels due to membrane protein toxicity

    • Inclusion body formation requiring refolding protocols

    • Improper membrane integration affecting protein functionality

  • Purification difficulties:

    • Selecting appropriate detergents that maintain native conformation

    • Aggregation during concentration steps

    • Co-purification of endogenous E. coli membrane proteins

  • Practical solutions:

    • Use lower induction temperatures (16-20°C) and reduced inducer concentrations

    • Screen multiple detergents for optimal solubilization

    • Consider fusion partners that enhance solubility (MBP, SUMO)

    • Implement stringent washing steps during affinity purification

Validation of proper folding is essential and can be assessed through circular dichroism spectroscopy or limited proteolysis assays to ensure the purified protein maintains its native conformation.

How can antibody specificity issues be addressed when studying closely related CASP family members?

Developing specific antibodies for CASP-like protein 5 requires strategic approaches:

  • Epitope selection:

    • Target unique sequences in variable regions, particularly in extracellular loops

    • Avoid conserved transmembrane domains shared among family members

  • Validation methods:

    • Test antibodies against recombinant proteins of multiple CASP family members

    • Validate with knockout/knockdown lines as negative controls

    • Perform peptide competition assays to confirm specificity

  • Alternative approaches:

    • Use epitope tagging of the endogenous gene via CRISPR/Cas9

    • Develop isoform-specific RNA probes for expression analysis

    • Employ mass spectrometry-based proteomics with unique peptide identification

When western blotting, use stringent washing conditions and titrate antibody concentrations to minimize cross-reactivity with related family members.

What strategies can overcome difficulties in generating stable transgenic soybean lines for CASP-like protein 5 functional studies?

Generating stable transgenic soybean lines presents several challenges:

  • Transformation optimization:

    • Select appropriate explants (cotyledonary nodes or half-seeds)

    • Optimize Agrobacterium strain and infection conditions

    • Consider alternative methods like particle bombardment for recalcitrant varieties

  • Expression construct design:

    • Use codon-optimized sequences for improved expression

    • Select promoters based on desired expression pattern (constitutive vs. tissue-specific)

    • Include introns to enhance expression levels

  • Selection strategies:

    • Employ efficient selection markers (herbicide resistance preferred over antibiotic resistance)

    • Implement visual markers (e.g., GFP) for early screening

    • Use molecular characterization (PCR, Southern blot) to confirm integration

  • Addressing silencing issues:

    • Include matrix attachment regions (MARs) to reduce position effects

    • Consider using inducible expression systems if constitutive expression is problematic

    • Screen multiple independent lines to identify stable expressors

For functional studies, create both overexpression and RNAi/CRISPR knockout lines to comprehensively assess protein function through gain- and loss-of-function approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.