Recombinant Glycine max CASP-like protein 6

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Glycine Max CASP-Like Protein 6

Recombinant Glycine max CASP-like protein 6 is a full-length protein consisting of 188 amino acids derived from soybean (Glycine max). The protein is identified in UniProt database with the accession number C6TBD0 and is also known by synonyms such as CASP-like protein 1E1 or GmCASPL1E1 . The recombinant form of this protein is typically produced with an N-terminal histidine tag to facilitate purification and experimental applications.

CASP-like proteins in plants represent a family of proteins with structural similarities to Casparian strip membrane domain proteins (CASPs). While they share some characteristics with caspases found in animals, their functions in plants are distinct and involve different cellular processes, particularly related to membrane organization and plant defense mechanisms.

Expression Systems and Methods

Recombinant Glycine max CASP-like protein 6 is typically expressed in Escherichia coli expression systems with an N-terminal histidine tag to facilitate purification . The recombinant production method involves:

  1. Cloning the coding sequence of Glycine max CASP-like protein 6 into an appropriate expression vector

  2. Transforming E. coli cells with the recombinant vector

  3. Inducing protein expression under optimized conditions

  4. Cell lysis and protein extraction

  5. Purification using affinity chromatography targeting the histidine tag

This approach yields a purified recombinant protein with over 90% purity as determined by SDS-PAGE analysis .

Comparative Analysis with Other CASP-Like Proteins

Gene expression studies have shown that different CASP-like proteins in Glycine max respond differently to various stress conditions. For example, CASP-like protein 5 has been observed to be significantly upregulated (log2FC 3.69) in specific conditions . While direct data on CASP-like protein 6 expression patterns is limited in the provided search results, the differential regulation of related family members suggests that these proteins may play roles in plant stress responses.

Membrane Organization and Cell Wall Integrity

Based on structural characteristics and similarities to other CASP-like proteins, Glycine max CASP-like protein 6 likely plays a role in membrane organization and potentially in maintaining cell wall integrity. The hydrophobic regions in its sequence suggest integration into cellular membranes, where it may participate in forming specialized membrane domains or barriers.

Possible Roles in Plant Defense

While direct evidence for the role of CASP-like protein 6 in plant defense is limited in the provided search results, studies on other proteins in Glycine max provide some context. For instance, the Glycine max disease resistant 1 (GmDR1) protein has been shown to confer broad-spectrum resistance against various pathogens, including Fusarium virguliforme, Heterodera glycines, Tetranychus urticae, and Aphis glycines .

GmDR1 appears to function as a pattern recognition receptor that recognizes pathogen- and pest-associated molecular patterns (PAMPs) and activates defense responses. Given that many CASP-like proteins are involved in membrane organization, it is plausible that CASP-like protein 6 might function in conjunction with or in parallel to such defense mechanisms, potentially by helping to establish structural barriers or participating in signaling cascades .

Current Applications in Plant Biology Research

Recombinant Glycine max CASP-like protein 6 serves as a valuable tool for various research applications:

  1. Structural studies to determine protein conformation and membrane integration

  2. Protein-protein interaction studies to identify binding partners

  3. Functional assays to elucidate biological roles

  4. Generation of antibodies for detection and localization studies

  5. Comparative analyses with other CASP-like proteins

The availability of purified recombinant protein facilitates these applications and contributes to advancing our understanding of plant membrane biology and defense mechanisms.

Potential Biotechnological Applications

Understanding the functions of CASP-like proteins in Glycine max could lead to biotechnological applications, particularly in developing crop protection strategies. If CASP-like protein 6 is confirmed to have roles in plant defense, it might be exploited for:

  1. Development of transgenic crops with enhanced resistance to pathogens

  2. Design of molecular breeding strategies targeting CASP-like protein expression

  3. Creation of biomarkers for monitoring plant stress responses

  4. Development of novel biopesticides based on protein function

Comparison with Animal Caspases

While plant CASP-like proteins share nomenclature with animal caspases, they represent distinct protein families with different functions. Animal caspases, such as human CASP6 (Caspase 6), are cysteine-aspartic acid proteases that play central roles in programmed cell death (apoptosis) . In contrast, plant CASP-like proteins are more closely related to Casparian strip membrane domain proteins and function primarily in membrane organization rather than proteolytic cascades.

Human CASP6, for example, is processed by caspases 7, 8, and 10, and functions as a downstream enzyme in the caspase activation cascade during apoptosis . It is also involved in neurodegenerative conditions such as Huntington's Disease and Parkinson's Disease. This functional divergence highlights the independent evolution of these protein families despite similar naming conventions.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preferences in the order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. We kindly request that you consult with your local distributors for specific delivery timelines.
All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration ranging from 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
CASP-like protein 1E1; GmCASPL1E1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Glycine max (Soybean) (Glycine hispida)
Target Protein Sequence
MEGVESKEREVMVAKPVAVVGVCDLLLRLLAFTVTLVAAIVIAVDKQTKLVPIQLSDSFP PLNVPLTAKWHQMSAFVYFLVTNAIACTYAAMSLLLALVNRGKSKGLWTLIAVLDTFMVA LLFSGNGAAAAVGILGYKGNSHVNWNKVCNVFGKFCDQMAASIGVSLIGSLAFLLLVVIP VVRLHRRT
Uniprot No.

Target Background

Database Links

KEGG: gmx:100793096

UniGene: Gma.764

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does the structure of Glycine max CASP-like protein 6 compare to similar proteins in other plant species?

Glycine max CASP-like protein 6 shares structural homology with CASP-like proteins found in other plant species. Sequence analysis reveals conserved domains that suggest evolutionary preservation of key functional regions. The protein contains characteristic transmembrane domains and signal peptide sequences that position it within the broader family of plant CASP-like proteins.

A comparative structural analysis would reveal:

FeatureGlycine max CASP-like protein 6Other Plant CASP-like Proteins
Length188 amino acids180-200 amino acids (typical)
Transmembrane domainsPresentPresent, similarly positioned
Signal peptideN-terminal regionN-terminal region
Conserved motifsCASP family signaturesCASP family signatures

Recombinant expression with an N-terminal His-tag in E. coli suggests the protein can maintain its structural integrity in heterologous expression systems, making it amenable to comparative structural studies .

What is currently known about the biological function of CASP-like proteins in plants?

CASP-like proteins in plants are thought to play important roles in cellular signaling, membrane organization, and potentially stress responses. While specific functions of Glycine max CASP-like protein 6 remain under investigation, related proteins have been implicated in:

  • Cell wall organization and biogenesis

  • Membrane trafficking and protein transport

  • Responses to abiotic and biotic stresses

  • Developmental processes and cellular differentiation

Understanding the function of these proteins often requires integration of multiple experimental approaches, including glycoproteomic analysis similar to that described for other plant proteins involved in cellular signaling networks.

What expression systems are optimal for producing recombinant Glycine max CASP-like protein 6?

The documented successful expression system for Glycine max CASP-like protein 6 is E. coli, which produces the full-length protein (amino acids 1-188) with an N-terminal His-tag . When designing your expression system, consider:

  • E. coli expression advantages:

    • High yield potential

    • Well-established protocols

    • Cost-effective production

    • Efficient for proteins without complex post-translational modifications

  • Optimization parameters:

    • Induction conditions (temperature, IPTG concentration)

    • Growth media composition

    • Expression strain selection (BL21, Rosetta, etc.)

    • Codon optimization for E. coli

  • Alternative expression systems to consider:

    • Insect cell systems (for membrane proteins)

    • Plant-based expression (for authentic plant post-translational modifications)

    • Cell-free systems (for difficult-to-express proteins)

For membrane-associated proteins like CASP-like protein 6, detergent selection during purification is critical for maintaining native conformation and function after expression .

What are the recommended protocols for reconstituting and handling lyophilized Glycine max CASP-like protein 6?

Proper reconstitution and handling of lyophilized Glycine max CASP-like protein 6 is crucial for experimental success. Follow these methodological guidelines:

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening to ensure all material is at the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is recommended)

    • Aliquot for long-term storage at -20°C/-80°C

  • Storage considerations:

    • Store unopened product at -20°C/-80°C

    • Working aliquots can be stored at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as this can compromise protein integrity

    • Store in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Quality control measures:

    • Verify protein integrity by SDS-PAGE (>90% purity expected)

    • Perform activity assays appropriate to experimental needs

    • Consider pilot experiments to confirm protein functionality before large-scale studies

These handling procedures are designed to maintain protein stability and function throughout your experimental workflow .

What analytical techniques are most effective for characterizing recombinant Glycine max CASP-like protein 6?

Multiple analytical approaches can be employed to thoroughly characterize recombinant Glycine max CASP-like protein 6:

  • Protein purity and integrity assessment:

    • SDS-PAGE with Coomassie staining (>90% purity expected)

    • Western blotting with anti-His antibodies for tag verification

    • Mass spectrometry for precise molecular weight determination and sequence verification

  • Structural characterization:

    • Circular dichroism (CD) spectroscopy for secondary structure analysis

    • Size exclusion chromatography to assess oligomeric state

    • Dynamic light scattering for homogeneity assessment

    • X-ray crystallography or cryo-EM for high-resolution structural information

  • Functional analysis:

    • Membrane association studies

    • Protein-protein interaction assays (pull-downs, surface plasmon resonance)

    • Functional reconstitution in liposomes

  • Post-translational modification analysis:

    • Glycoproteomics approaches similar to those described in literature for membrane-associated proteins

    • Phosphorylation state analysis

    • Other relevant PTM detection methods

When designing these analyses, consider the specific biochemical properties of CASP-like proteins and their predicted membrane association .

How can recombinant Glycine max CASP-like protein 6 be used in protein-protein interaction studies?

Investigating protein-protein interactions (PPIs) involving Glycine max CASP-like protein 6 requires specialized approaches due to its membrane-associated nature:

  • In vitro interaction methods:

    • Pull-down assays using the His-tag as bait

    • Surface plasmon resonance (SPR) with immobilized CASP-like protein 6

    • Isothermal titration calorimetry (ITC) for binding thermodynamics

    • Microscale thermophoresis for interaction kinetics

  • Cell-based interaction approaches:

    • Split reporter systems (yeast two-hybrid with membrane adaptations)

    • Bimolecular fluorescence complementation (BiFC)

    • Proximity labeling techniques (BioID, APEX)

    • Co-immunoprecipitation from plant or heterologous expression systems

  • Bioinformatic prediction and validation workflow:

    • In silico prediction of interaction partners

    • Conservation analysis across species

    • Structural docking simulations

    • Experimental validation of predicted interactions

These methodologies can help elucidate potential roles of CASP-like protein 6 in signaling networks, similar to approaches used for other membrane-associated proteins in plant systems.

What approaches are suitable for investigating the role of Glycine max CASP-like protein 6 in stress response?

Investigating potential stress response functions of Glycine max CASP-like protein 6 requires a multi-faceted experimental approach:

  • Expression analysis under stress conditions:

    • qRT-PCR for transcript-level changes

    • Western blotting for protein-level changes

    • Promoter-reporter constructs for transcriptional regulation studies

    • Ribosome profiling for translational regulation analysis

  • Functional genetic approaches:

    • CRISPR/Cas9-mediated knockout or knockdown (similar to approaches described for galectin-1 in search result )

    • Overexpression studies in model systems

    • Complementation assays in knockout backgrounds

    • Site-directed mutagenesis of key residues

  • Cellular localization during stress:

    • Fluorescent protein fusions

    • Immunolocalization under different stress conditions

    • Subcellular fractionation and Western blotting

    • Live cell imaging during stress application

  • Biochemical activity analysis:

    • In vitro activity assays under varying conditions

    • Post-translational modification changes under stress

    • Structural changes measured by spectroscopic methods

These approaches can help establish whether CASP-like protein 6 undergoes relocalization, modification, or functional changes during plant stress responses.

How might glycosylation impact the function of Glycine max CASP-like protein 6?

While specific glycosylation data for Glycine max CASP-like protein 6 is not explicitly mentioned in the search results, we can draw insights from general principles of protein glycosylation and the glycoproteomic methodologies described in search result :

  • Potential glycosylation analysis:

    • Examination of amino acid sequence for N-glycosylation motifs (NxS/T/C)

    • Mass spectrometry-based glycopeptide identification

    • Glycan profiling using lectin-based approaches

    • Site-specific glycan analysis using similar approaches to those described for other glycoproteins

  • Functional implications of glycosylation:

    • Protein folding and stability

    • Membrane trafficking and localization

    • Protein-protein interactions

    • Protection from proteolytic degradation

  • Experimental approaches to study glycosylation effects:

    • Comparison of E. coli-expressed protein (lacking glycosylation) with plant-expressed versions

    • Site-directed mutagenesis of potential glycosylation sites

    • Treatment with glycosidases to remove glycans

    • Expression in systems with altered glycosylation machinery

  • Analytical workflow for glycoprotein characterization:

    • Enrichment of glycopeptides using zwitterionic-hydrophilic interaction liquid chromatography

    • MS/MS analysis with multiple fragmentation approaches (HCD and pdEThcD)

    • Quantitative analysis using stable isotope labeling (similar to TMT approach described in )

Understanding the glycosylation state of CASP-like protein 6 could provide important insights into its biological function, particularly if it participates in glycan-mediated signaling networks .

What are common challenges in recombinant expression of Glycine max CASP-like protein 6 and how can they be resolved?

Researchers may encounter several challenges when working with recombinant Glycine max CASP-like protein 6. Here are methodological solutions to common issues:

  • Low expression yield:

    • Optimize codon usage for expression host

    • Test different E. coli strains (BL21, Rosetta, Arctic Express)

    • Adjust induction parameters (temperature, IPTG concentration, duration)

    • Consider fusion partners to enhance solubility (MBP, SUMO, TrxA)

  • Protein insolubility/aggregation:

    • Reduce expression temperature (16-20°C)

    • Include solubilizing additives in lysis buffer (glycerol, mild detergents)

    • Test different buffer compositions and pH conditions

    • Consider membrane protein-specific solubilization approaches

  • Protein degradation:

    • Include protease inhibitors during purification

    • Optimize purification speed and temperature

    • Test different storage conditions

    • Consider alternative buffer formulations to the recommended Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Low protein activity:

    • Ensure proper folding through refolding protocols if needed

    • Verify integrity through analytical techniques

    • Test different reconstitution methods beyond the standard recommendation of 0.1-1.0 mg/mL in deionized sterile water

    • Examine the effect of cofactors or binding partners on activity

Maintaining detailed experimental notes and systematic troubleshooting approaches are essential for overcoming these challenges.

How should researchers interpret conflicting data regarding Glycine max CASP-like protein 6 localization or function?

When facing conflicting data about Glycine max CASP-like protein 6, employ these methodological strategies for resolution:

  • Critical evaluation of experimental approaches:

    • Assess differences in expression systems (E. coli vs. plant-based systems)

    • Compare purification strategies and their effects on protein structure

    • Evaluate tag positions (N-terminal vs. C-terminal) and their potential interference

    • Consider differences in detection methods and their sensitivities

  • Contextual biological factors:

    • Examine developmental stage differences in experimental systems

    • Consider environmental conditions and stress factors

    • Analyze genetic background variations

    • Assess tissue-specific expression patterns

  • Methodological reconciliation approaches:

    • Design experiments that directly compare conflicting methods

    • Employ orthogonal techniques to validate findings

    • Use combinatorial approaches that incorporate multiple methods

    • Consider temporal dynamics in protein function and localization

  • Statistical and bioinformatic analysis:

    • Perform meta-analysis of available data

    • Use statistical approaches to evaluate significance of differences

    • Apply machine learning to identify patterns in conflicting datasets

    • Conduct comparative genomic analysis across species

This systematic approach can help distinguish genuine biological complexity from technical artifacts in your research data.

What quality control measures should be implemented when working with recombinant Glycine max CASP-like protein 6?

Implementing rigorous quality control is essential for reliable research with recombinant Glycine max CASP-like protein 6:

  • Physical and chemical characterization:

    • SDS-PAGE analysis to confirm >90% purity as expected

    • Mass spectrometry to verify protein integrity and molecular weight

    • Circular dichroism to assess secondary structure

    • Dynamic light scattering for aggregation assessment

  • Functional validation:

    • Binding assays for predicted interaction partners

    • Activity assays relevant to hypothesized function

    • Stability testing under experimental conditions

    • Lot-to-lot consistency evaluation

  • Storage and handling verification:

    • Stability testing after recommended storage at -20°C/-80°C

    • Functionality assessment after reconstitution

    • Monitoring during repeated freeze-thaw cycles (though these should be avoided)

    • Verification of protein stability in working buffers

  • Documentation and reporting standards:

    • Detailed methods sections in publications

    • Raw data preservation and sharing

    • Transparent reporting of quality control outcomes

    • Inclusion of relevant controls in all experiments

Quality ParameterAcceptance CriteriaMethod
Purity>90%SDS-PAGE
IdentityMatch to expected sequenceMass spectrometry
SolubilityClear solution at working concentrationVisual inspection
FunctionActivity within established rangeProtein-specific assays

How might emerging technologies enhance our understanding of Glycine max CASP-like protein 6?

Several cutting-edge technologies offer promising avenues for deeper insights into Glycine max CASP-like protein 6:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy for membrane protein structures

    • Integrative structural biology combining multiple data types

    • AlphaFold2 and similar AI-based structure prediction tools

    • Single-molecule FRET for dynamic structural information

  • Spatial and temporal profiling technologies:

    • Single-cell proteomics for cell-specific expression patterns

    • Spatial transcriptomics for tissue-specific expression mapping

    • Advanced live-cell imaging with super-resolution techniques

    • Optogenetic tools for temporal control of protein function

  • High-throughput functional screening:

    • CRISPR-based functional genomics (similar to approaches used for galectin-1 in )

    • Massively parallel reporter assays for regulatory elements

    • Proteome-wide interaction mapping

    • Phenomics approaches for systematic phenotypic analysis

  • Systems biology integration:

    • Multi-omics data integration

    • Network modeling of protein interactions

    • Comparative systems analysis across species

    • Machine learning for pattern recognition in complex datasets

These technologies can be applied in complementary ways to build a comprehensive understanding of CASP-like protein 6 biology beyond what is currently known.

What are the potential applications of Glycine max CASP-like protein 6 research in plant biotechnology?

Understanding Glycine max CASP-like protein 6 could contribute to various biotechnological applications:

  • Crop improvement strategies:

    • Engineering stress tolerance if CASP-like protein 6 is involved in stress responses

    • Modifying developmental pathways for desired agronomic traits

    • Optimizing cellular signaling for enhanced growth or yield

    • Biofortification applications if involved in nutrient transport

  • Biopharmaceutical applications:

    • Platform for recombinant protein production

    • Target for modulating plant-derived bioactive compounds

    • Model system for membrane protein studies

    • Potential for protein engineering applications

  • Diagnostic and research tools:

    • Development of antibodies or aptamers as molecular probes

    • Creation of biosensors for monitoring plant health

    • Reporter systems for cellular processes

    • Teaching tools for plant molecular biology

  • Fundamental knowledge advancement:

    • Deeper understanding of plant membrane biology

    • Insights into protein evolution across species

    • Models for protein-lipid interactions

    • Foundation for comparative studies across plant species

These applications demonstrate how basic research on CASP-like protein 6 can translate into practical biotechnological outcomes with agricultural and industrial relevance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.