Recombinant Glycine max CASP-like protein 7

Shipped with Ice Packs
In Stock

Description

Introduction to CASP-Like Proteins in Plants

The Casparian strip membrane domain (CASP) protein family represents an important group of plant proteins initially associated with the formation of Casparian strips in plant roots. CASP-like proteins (CASPLs) are structurally related to the core CASP proteins but display diverse expression patterns and functions across plant tissues. These proteins are integral membrane components characterized by multiple transmembrane domains that anchor them within cellular membranes.

The CASP protein family in Arabidopsis comprises approximately 39 genes, organized into six subfamilies based on sequence homology and evolutionary relationships . While the five core CASP proteins (CASP1-5) are primarily involved in Casparian strip formation, CASP-like proteins appear to have broader roles in plant development and stress responses. Research indicates that these proteins may function in membrane subdomain formation and organization in various cell types beyond the endodermis where Casparian strips are formed .

Glycine max (soybean), an economically important legume crop, possesses several CASP-like protein genes, including the CASP-like protein 7 gene. Understanding the structure and function of these proteins provides valuable insights into plant membrane biology and potential applications in agricultural improvement.

Evolutionary Significance of CASP-Like Proteins

CASP-like proteins represent an evolutionarily conserved family found across diverse plant species. Studies comparing CASP-like genes between different plants, such as watermelon (Citrullus lanatus) and Arabidopsis thaliana, have revealed significant conservation in protein structure and function despite evolutionary divergence . This conservation suggests fundamental roles for these proteins in plant cellular processes.

Phylogenetic analyses have placed CASP-like protein 7 from Glycine max within a specific subfamily of the larger CASP protein family. While direct phylogenetic information for Glycine max CASP-like protein 7 is limited in the provided search results, research on related CASP-like proteins in other species provides context for understanding its evolutionary relationships and potential functions.

Comparison with Other CASP-Like Proteins

While specific comparative analyses of Glycine max CASP-like protein 7 with other CASP-like proteins are not directly presented in the search results, research on related proteins provides context. For instance, CASP-like proteins from Arabidopsis and watermelon have been shown to share structural features despite differences in amino acid sequences .

The protein's UniProt ID is C6SVQ5, which provides a standardized reference for further comparative studies and functional analyses . This identifier facilitates integration with existing protein databases and research on the broader CASP protein family.

Recombinant Production and Purification Methods

Recombinant Glycine max CASP-like protein 7 is produced using established expression systems that allow for consistent protein production and purification for research applications.

Expression System

The recombinant protein is expressed in Escherichia coli bacterial expression systems, which offer several advantages for protein production, including rapid growth, high yield, and well-established protocols . The full-length protein (amino acids 1-193) is fused to an N-terminal His-tag, which facilitates purification and detection in experimental settings .

The His-tagged recombinant protein provides researchers with a valuable tool for investigating the structure and function of CASP-like protein 7. The tag's minimal size helps preserve the protein's native conformation while enabling efficient purification through affinity chromatography.

Reconstitution Protocol

For experimental use, specific reconstitution protocols are recommended:

  1. Centrifuge the vial briefly before opening to bring contents to the bottom .

  2. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  3. Addition of glycerol (5-50% final concentration) is recommended for long-term storage, with 50% glycerol being the default recommendation .

These handling and reconstitution protocols help ensure the stability and activity of the recombinant protein for research applications.

Potential Biological Functions

While the specific functions of Glycine max CASP-like protein 7 are not directly detailed in the search results, research on related CASP-like proteins provides insights into its potential biological roles.

Membrane Organization and Casparian Strip Formation

CASP proteins were originally identified for their role in Casparian strip formation in plant roots. Casparian strips are specialized cell wall modifications in the endodermis that create a diffusion barrier, controlling water and nutrient uptake . While the five core CASP proteins (CASP1-5) are known to mediate Casparian strip formation, the specific contribution of CASP-like protein 7 to this process remains to be fully elucidated.

Research on Arabidopsis has shown that some CASP-like proteins may have roles beyond Casparian strip formation. For instance, the Arabidopsis CASPL4C1 gene (At3g55390), which is orthologous to a CASP-like gene in watermelon, has been found to be widely expressed across various plant tissues, suggesting functions beyond the endodermis .

Potential Role in Plant Growth and Development

Studies of CASP-like proteins in other plant species suggest potential roles in regulating plant growth and development. For example, analysis of Arabidopsis plants with T-DNA knockouts of the AtCASPL4C1 gene showed altered growth dynamics, including faster growth, increased biomass, and earlier flowering compared to wild-type plants .

These findings suggest that CASP-like proteins, including potentially Glycine max CASP-like protein 7, may function as negative regulators of plant growth under certain conditions. The widespread expression of related CASP-like genes in vascular tissues further suggests fundamental roles in plant development beyond specialized structures like Casparian strips .

Stress Response Mechanisms

Research on CASP-like proteins in watermelon and Arabidopsis has revealed potential roles in plant responses to environmental stresses, particularly cold stress. A CASP-like gene in watermelon (ClCASPL) was identified as cold-induced, and its ortholog in Arabidopsis (AtCASPL4C1) was found to play an important role in cold tolerance .

Interestingly, knockout of AtCASPL4C1 in Arabidopsis resulted in elevated tolerance to cold stress, while overexpression of the watermelon ClCASPL gene increased sensitivity to cold stress . These findings suggest that certain CASP-like proteins may negatively regulate cold tolerance mechanisms.

While direct evidence for Glycine max CASP-like protein 7's role in stress responses is not provided in the search results, its structural similarity to other CASP-like proteins suggests potential involvement in similar processes in soybean plants.

Comparative Analysis with Related Proteins

Understanding Glycine max CASP-like protein 7 benefits from comparative analysis with related proteins in soybean and other plant species.

Insights from CASP-Like Proteins in Other Species

Research on CASP-like proteins in watermelon and Arabidopsis has provided valuable insights into potential functions and regulatory mechanisms. The Arabidopsis genome contains approximately 39 genes in the CASP family (UPF0497), organized into six distinct subfamilies based on phylogenetic analysis .

Studies of AtCASPL4C1 in Arabidopsis have shown that it is widely expressed across various plant organs and is cold-inducible . Knockout of this gene resulted in altered growth dynamics and enhanced cold tolerance, suggesting regulatory roles in plant development and stress responses .

The localization of CASP-like proteins to the plasma membrane, as demonstrated for the watermelon ClCASPL protein using fluorescence microscopy, is consistent with the predicted membrane association of Glycine max CASP-like proteins . This common subcellular localization suggests similar molecular functions related to membrane organization and signaling.

Research Applications and Future Directions

Recombinant Glycine max CASP-like protein 7 serves as a valuable research tool for investigating plant membrane biology and cellular processes.

Current Research Applications

The availability of purified recombinant protein facilitates various research applications, including:

  1. Structural studies to determine three-dimensional protein conformation

  2. Protein-protein interaction analyses to identify binding partners

  3. Functional assays to investigate roles in membrane organization

  4. Development of antibodies for protein detection and localization studies

These applications contribute to our understanding of CASP-like protein functions in plant biology and potentially inform agricultural improvement strategies.

Future Research Directions

Based on current knowledge of CASP-like proteins, several promising research directions for Glycine max CASP-like protein 7 include:

  1. Functional characterization: Investigating its specific roles in soybean development and stress responses through gene knockout or overexpression studies.

  2. Expression analysis: Determining tissue-specific expression patterns and responses to environmental stresses.

  3. Protein interaction networks: Identifying interacting proteins to understand its integration into cellular signaling and structural networks.

  4. Comparative studies: Examining functional conservation and divergence across CASP-like proteins in different plant species.

  5. Applied research: Exploring potential applications in improving soybean crop traits, particularly related to stress tolerance and growth characteristics.

These research directions would significantly advance our understanding of this protein's biological significance and potential applications.

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we understand that you may have specific requirements. Please indicate any format preferences in your order notes, and we will do our best to accommodate your request.
Lead Time
Delivery time may vary based on your purchase method and location. We recommend contacting your local distributor for precise delivery estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point for your own protocols.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms exhibit a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please let us know, and we will prioritize its development.
Synonyms
CASP-like protein 1D2; GmCASPL1D2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-193
Protein Length
full length protein
Species
Glycine max (Soybean) (Glycine hispida)
Target Protein Sequence
MASTDKPGGDPEYRTSSTPAPAGVDYFKFDVILRFLLFAASLVAVVVIVTANQTEVIRVP QPVPWPAKFRYSPAFVYFVAALSVTGLYSIITTLASLLASNKPALKTKLLLYFILWDALI LGIIASATGTAGGVAYLGLKGNRHVVGWNKICHVYDKFCRHVGASIAVALFGSVVTVLLI WLSAYSIHSRVPK
Uniprot No.

Target Background

Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is CASP-like protein 7 in Glycine max and how does it differ from human CASP7?

Despite the similar nomenclature, Glycine max CASP-like protein 7 (GmCASPL1D2) is structurally and functionally distinct from human CASP7. While human CASP7 is a cysteine-aspartic acid protease involved in apoptosis and interferon regulation , Glycine max CASP-like protein 7 belongs to the plant Casparian Strip Membrane Protein family. The soybean protein is a membrane-associated protein with 193 amino acids that likely functions in membrane organization and barrier formation in plant tissues . This distinction is crucial for experimental design and interpretation, as the molecular mechanisms and cellular functions differ significantly between these proteins.

What are the known synonyms and database identifiers for this protein?

To ensure consistency in research documentation and database searches, researchers should be aware of the following identifiers:

Identifier TypeValue
UniProt IDC6SVQ5
Protein NameCASP-like protein 7
SynonymsCASP-like protein 1D2, GmCASPL1D2
OrganismGlycine max (Soybean)
Gene NameCASP-like protein 7

This protein should not be confused with human CASP7, which has entirely different functions and characteristics . When searching literature or databases, using the UniProt identifier C6SVQ5 is recommended for highest specificity.

What expression systems are optimal for producing recombinant Glycine max CASP-like protein 7?

Based on current research protocols, E. coli expression systems have been successfully employed for the recombinant production of Glycine max CASP-like protein 7 . For optimal expression, the following methodological considerations are recommended:

  • The full-length protein (amino acids 1-193) can be expressed with an N-terminal His-tag to facilitate purification.

  • Expression in BL21(DE3) or Rosetta strains may improve yield for this plant protein in bacterial systems.

  • Induction conditions should be optimized (typically IPTG concentration of 0.5-1mM at 16-25°C) to prevent formation of inclusion bodies due to the membrane-associated nature of the protein.

Alternative expression systems such as insect cells or plant-based expression might provide more native-like post-translational modifications but have not been extensively documented for this specific protein in the available literature.

What purification strategies yield the highest purity and functional integrity for the recombinant protein?

Purification of Glycine max CASP-like protein 7 requires specific considerations due to its membrane-associated properties:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is effective for initial capture of the His-tagged protein.

  • Detergent selection is critical - mild non-ionic detergents (0.1% DDM or 0.5% CHAPS) can solubilize the protein while maintaining structural integrity.

  • Size exclusion chromatography as a polishing step can separate aggregates and improve homogeneity.

Current protocols achieve >90% purity as determined by SDS-PAGE analysis . The purified protein can be stored in Tris/PBS-based buffer containing 6% trehalose at pH 8.0, with addition of 5-50% glycerol for long-term storage at -20°C/-80°C . Researchers should avoid repeated freeze-thaw cycles as they can compromise protein integrity.

How can researchers verify the structural integrity of purified recombinant Glycine max CASP-like protein 7?

Multiple complementary approaches should be employed to verify structural integrity:

  • SDS-PAGE analysis confirms molecular weight (approximately 21 kDa plus tag size) and initial purity assessment.

  • Western blotting using anti-His antibodies or specific antibodies against the protein confirms identity.

  • Circular dichroism (CD) spectroscopy can assess secondary structure content, particularly important for confirming proper folding of transmembrane regions.

  • Limited proteolysis followed by mass spectrometry can verify domain organization and accessible regions.

For membrane proteins like CASP-like protein 7, additional biophysical techniques such as dynamic light scattering to assess homogeneity and aggregation state, and thermal shift assays to evaluate stability in different buffer conditions, provide valuable structural information before proceeding to functional studies.

What analytical methods are most effective for studying the membrane association properties of this protein?

Given the membrane-associated nature of CASP-like protein 7, specialized analytical approaches are necessary:

  • Liposome binding assays using fluorescently labeled protein or liposomes to quantify membrane interaction.

  • Sucrose density gradient centrifugation to assess membrane association properties.

  • Detergent resistance assays to evaluate interactions with membrane microdomains.

  • For advanced studies, reconstitution into nanodiscs or proteoliposomes followed by atomic force microscopy or cryo-electron microscopy can provide structural insights in a membrane environment.

These approaches address the challenges of studying membrane proteins while providing quantitative data on lipid interactions that may be central to the protein's biological function in plant cell membranes.

How does Glycine max CASP-like protein 7 relate to other CASP family proteins, and what orthology relationships exist?

Orthology analysis reveals that Glycine max CASP-like protein 7 (UniProt: C6SVQ5) belongs to a family of CASP-like proteins conserved across plant species. The protein shows significant sequence similarity to:

  • Other soybean CASP-like proteins: C6T1G0 (CASP-like protein 7) with 96.8% inparalog score and I1JE64 (CASP-like protein) with 96.1% inparalog score .

  • Orthologous proteins in other species, including Arabidopsis thaliana CASP5 (Casparian Strip Membrane Protein 5) .

  • Zea mays (corn) CASP-like proteins such as B6T959 (Casparian Strip Membrane Protein 1) .

These orthology relationships suggest conserved functions across species, potentially in the formation of Casparian strips or other membrane barrier structures in plants. Researchers can leverage this evolutionary conservation to infer functional properties from better-characterized orthologs in model plant species.

What are the proposed functions of CASP-like protein 7 in Glycine max, and how can these be experimentally validated?

While specific functions of Glycine max CASP-like protein 7 are not fully characterized in the search results, several approaches can be employed to investigate its biological roles:

  • Subcellular localization studies using fluorescently tagged versions of the protein to determine membrane compartment association.

  • Gene expression analysis under various stress conditions, as other plant CASP-related proteins have been implicated in stress responses .

  • Gene silencing or CRISPR-based knockout studies to assess phenotypic effects on root development, nutrient uptake, or stress tolerance.

  • Protein-protein interaction studies to identify binding partners that may provide functional insights.

Based on related proteins, potential functions may include:

  • Formation of diffusion barriers in roots similar to Casparian strips

  • Involvement in abiotic stress responses, particularly salt, drought, or cold stress

  • Membrane remodeling during developmental processes

How might CASP-like protein 7 contribute to abiotic stress tolerance in Glycine max?

While direct evidence for CASP-like protein 7's role in stress tolerance is limited in the search results, research on related plant proteins suggests potential involvement in stress responses:

  • GRP (glycine-rich RNA-binding protein) family members in Arabidopsis influence stress tolerance, with GRP7 specifically affecting responses to salt, drought, and cold stress .

  • CASP family proteins are involved in formation of membrane barriers that regulate water and nutrient transport, which are critical processes during stress responses.

To investigate this experimentally:

  • Compare expression levels of CASP-like protein 7 under various stress conditions (salt, drought, cold) using qRT-PCR or RNA-seq analysis

  • Generate transgenic soybean lines with altered expression levels to assess changes in stress tolerance

  • Examine protein localization changes under stress conditions using fluorescently tagged protein

  • Analyze metabolomic and ionomic profiles in plants with altered CASP-like protein 7 expression to identify specific pathways affected

These approaches could reveal whether CASP-like protein 7 functions similarly to other plant proteins that modulate stomatal regulation or water transport during stress conditions .

What structural and functional relationships exist between CASP-like protein 7 and seed storage proteins in Glycine max?

The search results suggest a complex relationship between membrane proteins like CASP-like protein 7 and seed storage proteins in Glycine max:

  • While CASP-like protein 7 is a membrane protein, seed storage proteins like beta-conglycinin (7S protein) have different structural characteristics and cellular locations .

  • Both protein families may be subject to similar transcriptional regulation mechanisms, as conserved sequences in gene flanking regions have been identified in various soybean proteins .

  • Post-translational modifications, particularly glycosylation patterns, might reveal functional connections between these protein families .

Advanced research approaches to explore these relationships include:

  • Comparative promoter analysis to identify shared regulatory elements

  • Co-expression network analysis during seed development stages

  • Protein-protein interaction studies to identify potential physical interactions during trafficking or maturation

  • Structural biology approaches to compare conserved domains or motifs that might have evolutionary relationships

Understanding these relationships could provide insights into the coordination of membrane organization and storage protein deposition during seed development in soybean.

What methodological challenges exist when investigating protein-protein interactions involving membrane-associated proteins like CASP-like protein 7?

Studying protein-protein interactions (PPIs) for membrane-associated proteins presents specific technical challenges that require specialized approaches:

  • Traditional yeast two-hybrid systems are often ineffective for membrane proteins due to membrane localization requirements.

  • Modified split-ubiquitin membrane yeast two-hybrid systems can overcome this limitation but require careful design.

  • In planta approaches such as bimolecular fluorescence complementation (BiFC) or Förster resonance energy transfer (FRET) provide more native-like conditions but have sensitivity limitations.

  • Co-immunoprecipitation methods require optimization of detergent conditions that solubilize the protein without disrupting interactions.

For CASP-like protein 7 specifically, researchers should consider:

  • Using proximity-based labeling approaches like BioID or APEX to identify neighboring proteins in membrane environments

  • Employing cross-linking mass spectrometry (XL-MS) to capture transient interactions

  • Developing reconstituted membrane systems with purified components to validate direct interactions

  • Combining genetic approaches (suppressor screens, synthetic lethality) with biochemical methods for comprehensive interaction mapping

These methodological considerations are essential for generating reliable data on the interactome of CASP-like protein 7 in its native membrane environment.

How should researchers interpret conflicting localization data for CASP-like protein 7?

Membrane proteins often show complex subcellular distributions that can appear contradictory between experiments. When encountering conflicting localization data for CASP-like protein 7, consider:

  • Different experimental techniques have varying sensitivity and specificity - compare results from multiple approaches (fluorescent protein fusions, immunolocalization, subcellular fractionation).

  • Protein localization may change during development, under stress conditions, or in different tissues - carefully document experimental conditions.

  • Overexpression artifacts may cause mislocalization - validate with complementary approaches showing endogenous protein localization.

  • N- or C-terminal tags may interfere with targeting signals - test both configurations and consider internal tagging strategies.

To resolve conflicts, systematic analysis using multiple experimental approaches under standardized conditions is recommended, with careful attention to the developmental stage and physiological state of the plant material.

What are the best practices for ensuring reproducibility in functional studies of CASP-like protein 7?

Reproducibility challenges in plant membrane protein research require systematic approaches:

  • Standardize growth conditions completely (light intensity/duration, temperature, humidity, soil composition, plant age) as these factors significantly impact protein expression and function.

  • Use multiple independent transgenic lines (minimum three) for overexpression or knockout studies to account for position effects.

  • Include appropriate controls for each experiment:

    • Empty vector controls for expression studies

    • Wild-type plants grown under identical conditions

    • Well-characterized related proteins as comparative references

  • Validate protein expression levels quantitatively using western blotting and qRT-PCR.

  • Document all protein purification and storage conditions in detail, including buffer compositions, detergent concentrations, and storage duration.

By implementing these practices, researchers can generate more reliable and reproducible data when studying the functions of challenging proteins like CASP-like protein 7.

What emerging technologies might advance our understanding of CASP-like protein 7 function in planta?

Several cutting-edge approaches hold promise for elucidating the biological roles of CASP-like protein 7:

  • CRISPR-Cas9 base editing and prime editing techniques allow precise genetic modifications without complete gene disruption, enabling subtle alterations to specific domains or motifs.

  • Advanced imaging technologies:

    • Super-resolution microscopy to visualize membrane domain organization

    • Label-free imaging techniques to observe native protein in live tissues

    • Correlative light and electron microscopy to connect localization with ultrastructural context

  • Single-cell transcriptomics and proteomics to resolve cell-type specific expression patterns in complex tissues.

  • Cryo-electron tomography of cellular sections to visualize membrane protein complexes in their native environment.

  • Optogenetic approaches to manipulate protein activity with spatial and temporal precision.

These technologies could reveal dynamic aspects of CASP-like protein 7 function that are inaccessible with conventional approaches, particularly regarding its role in membrane organization during development and stress responses.

How might comparative genomics across legume species inform our understanding of CASP-like protein 7 evolution and function?

Comparative genomics approaches offer powerful insights into the evolutionary context and functional diversification of CASP-like protein 7:

  • Analysis of orthologous proteins across diverse legume species (Glycine max, Phaseolus vulgaris, Pisum sativum) can reveal conserved functional domains and species-specific adaptations .

  • Synteny analysis of genomic regions containing CASP-like genes may identify conserved gene clusters suggesting functional relationships.

  • Selection pressure analysis (dN/dS ratios) across orthologous sequences can identify domains under purifying or diversifying selection, indicating functional importance.

  • Correlation of sequence variations with ecological adaptations of different legume species may reveal connections to specific environmental challenges.

This evolutionary perspective can guide functional studies by highlighting conserved features likely essential for core functions versus variable regions that may contribute to species-specific adaptations to different environmental niches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.