Recombinant Glycine max CASP-like protein 9

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant forms are synthesized using yeast (Saccharomyces cerevisiae) or E. coli expression systems with N-terminal His tags for affinity chromatography . Key production parameters include:

ParameterSpecification
Expression HostYeast (CSB-YP513833GGV1) or E. coli (alternative constructs)
Purity>85% (yeast-derived) or >90% (E. coli-derived) via SDS-PAGE
StorageLyophilized powder stable at -80°C; reconstituted in Tris/PBS buffer with 6% trehalose
Reconstitution0.1–1.0 mg/mL in deionized water with 50% glycerol for long-term stability

Applications and Research Utility

ApplicationDescription
Plant BiotechnologyEngineered CASP variants could enhance nutrient use efficiency or stress tolerance in crops .
Structural StudiesUsed to resolve CASP architecture via cryo-EM or X-ray crystallography .
Interaction MappingScreens for binding partners (e.g., peroxidases, transporters) using pull-down assays .

Challenges and Future Directions

  • Expression Optimization: Low yields in yeast systems (e.g., 0.1–1.0 mg/mL) necessitate codon optimization or alternative hosts .

  • Functional Redundancy: Overlapping roles with other CASP-like proteins (e.g., GmCASP-like 1, 8) complicate gene-specific analyses .

  • In Vivo Validation: CRISPR/Cas9 knockout studies in soybean are needed to confirm roles in Casparian strip formation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements you may have. Please indicate your preference in the order notes section, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please let us know, and we will prioritize developing it according to your specifications.
Synonyms
CASP-like protein 1B1; GmCASPL1B1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-194
Protein Length
full length protein
Species
Glycine max (Soybean) (Glycine hispida)
Target Protein Sequence
MASENGDKLELAFSAVPDPKPKKDWVILSLRVVAFFATASATLVMAFNKQTKGMVVATIG TNPVTITLTAMFQHTPAFIFFVIVNAIASFYNLLVIGVEILGPQYDYKGLRLGLIAILDV MTMALAATGDGAATFMAELGRNGNSHARWDKICDKFEAYCNRGGVALVASFVGLILLLVV TVMSITKLLKLNRI
Uniprot No.

Target Background

Database Links

KEGG: gmx:100776930

UniGene: Gma.36802

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Glycine max CASP-like protein 9 and how is it classified among plant proteases?

Glycine max CASP-like protein 9 belongs to the family of cysteine proteases found in soybeans (Glycine max). These proteins share structural similarities with other CASP (Cysteine ASPartate proteases) family proteins that have been extensively studied in various organisms. While specific information on Glycine max CASP-like protein 9 is limited in the current literature, structural assessment frameworks such as those used in CASP (Critical Assessment of Protein Structure Prediction) competitions provide valuable insights into how these proteins are classified .

The methodology for classifying these proteins typically involves sequence alignment with known proteases, identification of conserved catalytic residues, and structural prediction modeling. Similar to how recombinant human proteins like Galectin-9 are characterized by their functional domains (such as carbohydrate recognition domains) , CASP-like protein 9 would be classified based on its catalytic domains and substrate specificity determinants.

What expression systems are most suitable for producing recombinant Glycine max CASP-like protein 9?

The choice of expression system for recombinant Glycine max CASP-like protein 9 should be guided by considerations of post-translational modifications, protein folding requirements, and intended experimental applications. Based on related protein expression methodologies, several systems warrant consideration:

The expression methodology should include optimization of codon usage for the selected host, inclusion of appropriate purification tags (His-tag or GST-tag), and careful consideration of solubility-enhancing strategies. For functional studies, validation of proper folding through activity assays would be essential, similar to the binding assays conducted for recombinant human Galectin-9 .

What purification strategies yield the highest purity of recombinant Glycine max CASP-like protein 9?

Effective purification of recombinant Glycine max CASP-like protein 9 typically employs a multi-step approach to achieve high purity while maintaining protein activity. Drawing from established protein purification methodologies, the following strategy is recommended:

Step 1: Initial Capture

  • Affinity chromatography using N-terminal or C-terminal tags (His-tag, GST-tag)

  • Consider immobilized metal affinity chromatography (IMAC) if using His-tagged constructs

Step 2: Intermediate Purification

  • Ion exchange chromatography based on the protein's calculated pI

  • Hydrophobic interaction chromatography to separate based on surface hydrophobicity

Step 3: Polishing

  • Size exclusion chromatography to remove aggregates and achieve final purity

  • Consider the addition of stabilizing agents during this step to prevent degradation

This approach resembles purification protocols used for other recombinant proteins, such as the CRP protein purification described in relation to CRISPR/Cas systems . For quality assessment, SDS-PAGE analysis combined with Western blotting can confirm purity and identity, while activity assays verify functional integrity post-purification.

How does the structural assessment of Glycine max CASP-like protein 9 compare with computational prediction methods used in CASP competitions?

The structural assessment of Glycine max CASP-like protein 9 presents challenges that parallel those encountered in CASP (Critical Assessment of Protein Structure Prediction) competitions. When comparing experimental structure determination with computational predictions, several methodological considerations emerge:

Assessment ParameterExperimental StructureComputational PredictionIntegrated Approach
Backbone geometryDetermined by X-ray or NMRAssessed via Ramachandran plotsRefinement improves physicality
Side chain positioningElectron density mapsRotamer librariesCombined evaluation with experimental data
Model confidenceResolution metricsStatistical potentialsEnhanced through iterative refinement
Domain organizationDirect observationTemplate-based modelingValidation through limited proteolysis

As observed in CASP9 assessments, refinement of computational models shows limited improvement over initial predictions . For Glycine max CASP-like protein 9, a combined approach would be optimal - using computational predictions to guide experimental structure determination, followed by refinement against experimental data. This methodology aligns with current practices in structural biology where "the refined models are useful for solving the crystallographic phase problem through molecular replacement" .

What mechanisms regulate the expression and activity of CASP-like proteins in Glycine max compared to CRISPR/Cas systems in bacteria?

While CASP-like proteins in plants and CRISPR/Cas systems in bacteria represent distinct protein families, examining their regulatory mechanisms reveals intriguing parallels in protein regulation that inform experimental approaches:

In bacterial CRISPR/Cas systems, regulation occurs through multiple mechanisms, including:

  • Metabolic control via the glycine cleavage system (GCS) that affects cas3 expression

  • cAMP receptor protein (CRP) activation of cas3 expression through binding to specific promoter regions

  • Epigenetic regulation involving H-NS proteins

For Glycine max CASP-like protein 9, regulation likely involves:

  • Tissue-specific expression patterns regulated by plant-specific transcription factors

  • Developmental stage-dependent expression

  • Response to environmental stresses (pathogen attack, wounding)

The methodological approach to study these regulatory mechanisms would include:

  • Promoter analysis using reporter constructs

  • ChIP-seq to identify transcription factor binding sites

  • Expression profiling under various conditions

  • EMSA and DNase I footprinting assays similar to those used to study CRP binding to cas3 promoters

This comparative analysis provides a framework for designing experiments to elucidate the regulatory mechanisms of CASP-like protein 9 in Glycine max.

What protein-protein interaction networks involve Glycine max CASP-like protein 9, and how can these interactions be characterized experimentally?

Understanding the protein-protein interaction (PPI) networks involving Glycine max CASP-like protein 9 requires a multifaceted experimental approach. Drawing from methodologies used to study protein interactions in other systems, the following research strategy is recommended:

Initial Network Identification:

  • Yeast two-hybrid screening against a Glycine max cDNA library

  • Co-immunoprecipitation followed by mass spectrometry

  • Proximity-dependent biotin identification (BioID) in planta

Interaction Validation and Characterization:

  • Biolayer interferometry or surface plasmon resonance to determine binding kinetics

  • FRET/BRET assays for in vivo interaction confirmation

  • Co-localization studies using fluorescently tagged proteins

Functional Relevance Assessment:

  • Mutagenesis of key binding interfaces identified through structural studies

  • Competition assays with predicted binding partners

  • Phenotypic analysis of plants with disrupted interactions

This comprehensive approach parallels methods used to study protein-binding proteins designed from target structures alone and could reveal interaction partners that modulate CASP-like protein 9 activity in Glycine max. For instance, binding assays similar to those used for Human Galectin-9 and TIM-3 (with apparent Kd <30 nM) could be adapted to characterize CASP-like protein 9 interactions, providing quantitative measurements of binding affinities.

What are the optimal conditions for assessing the proteolytic activity of recombinant Glycine max CASP-like protein 9?

Determining the optimal conditions for proteolytic activity assessment requires systematic evaluation of multiple parameters. The following methodology is recommended:

Buffer Optimization Matrix:

ParameterRange to TestEvaluation Method
pH5.0-8.0 (0.5 increments)Fluorogenic substrate hydrolysis
Temperature20-45°C (5°C increments)Kinetic measurements over time
Ionic strength50-300 mM NaClActivity normalized to control
Reducing agents0-10 mM DTT/β-MEComparison of enzyme stability
Metal ions±Ca²⁺, Mg²⁺, Zn²⁺ (1 mM)Enhancement/inhibition profiles

Substrate Specificity Assessment:

  • Synthetic peptides containing different P1-P4 positions

  • Combinatorial peptide libraries to map extended substrate recognition

  • Native plant protein substrates from Glycine max extracts

Activity Measurement Techniques:

  • Continuous fluorescence-based assays for real-time monitoring

  • HPLC analysis of digestion products

  • Gel-based activity assays with zymography

This methodological approach provides comprehensive characterization of enzymatic properties similar to those used for other recombinant proteins. Results should be validated by testing multiple protein batches to ensure reproducibility and eliminate preparation-specific artifacts.

How can recombinant Glycine max CASP-like protein 9 be stabilized for long-term storage and experimental use?

Protein stability is crucial for reproducible experimental results. Based on established methodologies for protein stabilization, the following protocol is recommended for recombinant Glycine max CASP-like protein 9:

Systematic Stability Screen:

Stabilization MethodFormulation VariablesAssessment Timeline
Buffer compositionHEPES, Tris, Phosphate (pH 6.5-8.0)0, 7, 14, 30, 90 days
CryoprotectantsGlycerol (5-20%), Sucrose (5-15%)Storage at -20°C and -80°C
Reducing environmentsDTT (1-5 mM), TCEP (0.5-2 mM)Activity retention %
Protein concentration0.1-5 mg/mLAggregation measured by DLS
Lyophilization±Trehalose, ±MannitolReconstitution recovery %

Stability Assessment Methods:

  • Enzymatic activity assays to measure functional retention

  • Circular dichroism to monitor secondary structure changes

  • Differential scanning fluorimetry to determine thermal stability

  • Size-exclusion chromatography to detect aggregation

This systematic approach resembles stability studies conducted for other recombinant proteins and enables identification of optimal storage conditions. The methodology should include accelerated stability testing at elevated temperatures (37°C) to predict long-term stability, similar to approaches used for therapeutic proteins.

What structural features distinguish Glycine max CASP-like protein 9 from other plant cysteine proteases, and how can these be investigated?

Investigating the unique structural features of Glycine max CASP-like protein 9 requires a combination of computational and experimental approaches:

Computational Structure Analysis:

  • Homology modeling based on related plant cysteine proteases

  • Molecular dynamics simulations to assess flexibility and substrate binding

  • Machine learning approaches for functional site prediction

Experimental Structure Determination:

  • X-ray crystallography (target resolution <2.0 Å)

  • NMR spectroscopy for solution structure and dynamics

  • Cryo-EM for larger assemblies or complexes

Structure-Function Relationship Investigation:

  • Site-directed mutagenesis of predicted catalytic residues

  • Domain swapping with related proteases

  • Hydrogen-deuterium exchange mass spectrometry to identify flexible regions

This multi-faceted approach draws on methodologies used in protein structure refinement assessment and design of protein-binding proteins . The integration of computational prediction with experimental validation is particularly important, as "the performance of the best groups [in structure prediction] has not improved" significantly in recent years , highlighting the continued need for experimental structure determination.

How should apparent contradictions between computational predictions and experimental data for Glycine max CASP-like protein 9 be resolved?

Resolving contradictions between computational predictions and experimental data requires a systematic methodological approach that acknowledges the limitations of both:

Contradiction Assessment Framework:

Type of ContradictionPotential CausesResolution Strategy
Structural discrepanciesForce field limitations, crystallization artifactsRefine computational models against experimental restraints
Activity predictionsIncomplete binding site modeling, allosteric effectsIntegrate dynamic simulations with functional assays
Stability differencesSolvent effects not captured in modelsExperimental validation in various buffer conditions
Binding partner predictionsTransient interactions, non-specific bindingOrthogonal binding assays with kinetic measurements

Methodological Resolution Process:

  • Critically evaluate the quality metrics of both computational and experimental data

  • Identify specific points of contradiction through quantitative comparison

  • Design targeted experiments to address the specific contradiction

  • Iteratively refine computational models with new experimental constraints

This approach aligns with observations from protein structure refinement in CASP9, which noted that "improvement in backbone geometry does not always mean better agreement with experimental data" . The methodology should incorporate multiple experimental techniques to overcome biases inherent to any single approach, similar to how multiple sampling strategies are needed for different refinement problems .

What bioinformatic approaches best predict substrate specificity of Glycine max CASP-like protein 9?

Predicting substrate specificity for Glycine max CASP-like protein 9 requires integration of multiple bioinformatic approaches with experimental validation:

Computational Prediction Methods:

ApproachMethodologyValidation Strategy
Sequence-based predictionPosition-specific scoring matrices from related proteasesCompare with positional scanning libraries
Structural modelingSubstrate docking and molecular dynamicsMutational analysis of binding pocket
Machine learningNeural networks trained on known protease-substrate pairsCross-validation with novel substrates
Evolutionary analysisConservation patterns in substrate binding regionsComparative studies across species

Integrated Prediction Workflow:

  • Initial predictions based on sequence similarity to characterized proteases

  • Refinement using structural models of the active site

  • Machine learning integration of multiple features

  • Experimental validation using designed peptide libraries

This methodological framework draws on approaches used in protein-binding design and should incorporate iterative refinement based on experimental feedback. The critical assessment aspect parallels CASP approaches , where predictions are systematically compared to experimental results to improve future prediction accuracy.

How does the post-translational modification profile of native versus recombinant Glycine max CASP-like protein 9 affect functional studies?

Post-translational modifications (PTMs) can significantly impact protein function, and differences between native and recombinant forms must be systematically characterized:

PTM Profiling Methodology:

PTM TypeDetection MethodFunctional Assessment
GlycosylationMass spectrometry, lectins, glycosidase sensitivityActivity before/after deglycosylation
PhosphorylationPhospho-specific antibodies, MS/MSActivity with phosphatase treatment
Proteolytic processingN-terminal sequencing, intact mass analysisComparison of different protein forms
Disulfide bondingNon-reducing vs. reducing SDS-PAGEActivity in different redox environments

Comparative Analysis Framework:

  • Comprehensive PTM mapping of native protein isolated from Glycine max

  • Parallel analysis of recombinant protein from different expression systems

  • Site-directed mutagenesis of identified PTM sites

  • Activity correlation with specific PTM patterns

This methodological approach recognizes that recombinant proteins may lack the native modification pattern, similar to how E. coli-derived human Galectin-9 protein may have different properties than the native form . The approach should include assessment of how different expression systems (bacterial, yeast, insect, plant) affect the PTM profile and subsequent functional properties.

What role might Glycine max CASP-like protein 9 play in plant defense mechanisms, and how can this be experimentally verified?

Investigating the potential role of Glycine max CASP-like protein 9 in plant defense requires a multi-level experimental approach:

Defense Role Investigation Methodology:

Experimental ApproachSpecific MethodsExpected Outcomes
Gene expression analysisRT-qPCR, RNA-seq following pathogen challengeDifferential expression patterns
Protein localizationImmunohistochemistry, GFP fusion studiesSubcellular relocalization during infection
Loss-of-function studiesCRISPR knockout, RNAi silencingAltered susceptibility phenotypes
Gain-of-function studiesOverexpression in model plantsEnhanced resistance profiles
Biochemical targetsProteomics of infected vs. healthy tissueIdentification of in vivo substrates

Mechanistic Investigation Framework:

  • Pathogen challenge assays with various biotic stressors

  • Temporal analysis of protein activation following infection

  • Identification of potential pathogen targets or plant signaling substrates

  • Reconstitution of defense pathways in heterologous systems

How can structure-guided protein engineering improve the catalytic efficiency of Glycine max CASP-like protein 9 for biotechnological applications?

Structure-guided protein engineering of Glycine max CASP-like protein 9 requires an integrated design approach that combines computational modeling with iterative experimental validation:

Engineering Strategy Framework:

Design ApproachMethodologySuccess Metrics
Rational designSite-directed mutagenesis of catalytic residueskcat/KM improvement
Semi-rational approachSaturation mutagenesis of binding pocketSubstrate specificity shifts
Directed evolutionError-prone PCR with activity screeningStability in non-native conditions
Domain swappingHybrid constructs with related proteasesNovel substrate recognition

Implementation Workflow:

  • Initial structural analysis to identify target sites for modification

  • Computational prediction of mutation effects on activity

  • High-throughput screening system development

  • Iterative cycles of mutation and selection

This approach aligns with protein design methodologies described for protein-binding proteins , which "start with a broad exploration of the vast space of possible binding modes... and then intensifies the search in the vicinity of the most promising" candidates . The engineering strategy should incorporate feedback from each round of mutations to refine the model for subsequent designs, similar to how "experimental data on nearly half a million computational designs and hundreds of thousands of point mutants provide detailed feedback" in protein-binding design.

What emerging technologies might advance our understanding of Glycine max CASP-like protein 9 structure and function in the next decade?

The study of Glycine max CASP-like protein 9 will likely be transformed by several emerging technologies in the coming decade:

Emerging Methodological Advances:

TechnologyCurrent LimitationsFuture Potential
AlphaFold and similar AI toolsLimited accuracy for novel foldsMore accurate structure prediction without templates
Single-molecule enzymologyTechnical challenges with plant proteinsDirect observation of catalytic steps
Cryo-EM advancesResolution limits for smaller proteinsAtomic resolution of protein-substrate complexes
In-cell structural biologyDifficulty in plant systemsNative structure determination in planta
Multi-omics integrationData interpretation challengesComprehensive understanding of protein networks

These technological advances will enable more sophisticated investigations similar to the "intensified search" approaches described for protein design and may overcome current limitations in protein structure refinement noted in CASP assessments . Researchers should prepare for these advances by developing appropriate experimental systems and computational frameworks that can leverage new technologies as they emerge.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.