Recombinant Glycine max Chlorophyll a-b binding protein 2, chloroplastic (CAB2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its development.
Synonyms
CAB2; Chlorophyll a-b binding protein 2, chloroplastic; LHCII type I CAB-2; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
35-256
Protein Length
Full Length of Mature Protein
Species
Glycine max (Soybean) (Glycine hispida)
Target Names
CAB2
Target Protein Sequence
RKTAPKTVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFHGLSADPETFAKNRELEVIHSR WAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWAT QVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEALAELKVKELKNGRLAMFS MFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATKLCPGK
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Glycine max Chlorophyll a-b binding protein 2 (CAB2) and what is its primary function?

Glycine max Chlorophyll a-b binding protein 2, chloroplastic (CAB2) is a light-harvesting complex protein found in soybeans (Glycine max). It functions primarily as part of the photosynthetic apparatus, specifically in light-harvesting complex II (LHCII). The protein binds chlorophyll a and b molecules and plays a crucial role in capturing light energy for photosynthesis. CAB2 is also recognized as a clock output gene in circadian rhythm research, making it valuable for studying interactions between photosynthesis and circadian regulation .

The protein has alternative designations including LHCII type I CAB-2 and the short name LHCP. Its amino acid sequence includes specific regions that enable its chlorophyll-binding capacity and chloroplast localization. The expression region spans amino acids 35-256 in the full-length protein .

How does CAB2 relate to the plant circadian clock system?

CAB2 (CHLOROPHYLL A/B-BINDING PROTEIN 2, AT1G29920) serves as a widely used clock output gene in plant molecular biology research. Its expression follows circadian patterns, making it an excellent marker for studying clock function. The expression of CAB2 is regulated by core clock components including CCA1 (CIRCADIAN CLOCK ASSOCIATED 1) and TOC1 (TIMING OF CAB EXPRESSION 1) .

Research has shown that disruptions to clock regulators can alter CAB2 expression patterns. For example, plants overexpressing the pathogen effector HaRxL10 display a shorter period of CAB2 expression compared to wild-type plants. These HaRxL10 overexpression plants also exhibit lower amplitude and reduced average expression of CAB2, demonstrating how pathogen effectors can manipulate host circadian systems .

What are the recommended storage conditions for recombinant CAB2 protein to maintain its stability?

For optimal stability of recombinant Glycine max CAB2 protein, the following storage conditions are recommended:

  • Short-term storage (up to one week): Maintain working aliquots at 4°C

  • Medium-term storage: Store at -20°C in Tris-based buffer with 50% glycerol (optimized specifically for this protein)

  • Long-term storage: Conserve at -80°C

It's important to note that repeated freezing and thawing cycles should be avoided as they can compromise protein integrity. Therefore, preparing small working aliquots upon initial thawing is strongly recommended .

What experimental designs are most suitable for studying CAB2's role in circadian rhythm regulation?

Time-series experimental designs are particularly appropriate for studying CAB2's role in circadian regulation. This approach involves collecting measurements at regular intervals over an extended period (typically 24-72 hours) to capture the full circadian cycle.

Based on recognized experimental design principles, researchers should consider:

  • Pre-test/Post-test Control Group Design: Compare CAB2 expression between treatment and control groups both before and after experimental manipulation.

  • Time-Series Experiment: Monitor CAB2 expression at regular intervals (typically every 2-4 hours) under constant conditions (usually constant light or constant darkness) to observe free-running rhythms.

  • Multiple Time-Series Design: Compare time-series data between wild-type and mutant/transgenic lines to evaluate how genetic modifications affect CAB2 expression patterns .

When analyzing time-series data for CAB2 expression, researchers should measure multiple parameters including:

  • Period (time between expression peaks)

  • Amplitude (difference between peak and trough expression)

  • Phase (timing of peak expression relative to environmental or experimental cues)

  • Average expression levels over time

How can recombinant CAB2 be used to investigate pathogen interference with plant circadian systems?

Recombinant CAB2 provides a valuable tool for investigating how pathogens manipulate plant circadian systems to enhance infection success. The methodological approach involves:

  • Expression System Comparison: Generate plant lines expressing recombinant CAB2 fused to reporter genes (like luciferase or GFP) under native promoters to visualize circadian rhythms.

  • Pathogen Challenge Protocol: Challenge these reporter lines with pathogens or individual effector proteins delivered via bacterial type III secretion systems (such as Pst DC3000 TTSS).

  • Time-Course Analysis: Perform time-course analyses of CAB2 expression after pathogen infection, comparing infected versus non-infected plants under constant environmental conditions.

  • Molecular Interaction Studies: Investigate whether pathogen effectors directly interact with components of the circadian clock that regulate CAB2 expression.

Research has demonstrated that the pathogen effector HaRxL10 alters CAB2 expression patterns, resulting in shorter periods and reduced amplitude. This effector appears to function by interacting with clock components that regulate CAB2, such as CCA1, potentially through interaction with the repressor CHE .

What methodological approaches can resolve discrepancies in CAB2 expression data between different experimental systems?

Resolving discrepancies in CAB2 expression data between different experimental systems requires systematic troubleshooting and methodological refinements:

  • System-Specific Calibration: Different expression systems (transient expression, stable transgenic plants, bacterial delivery systems) may produce varying levels of protein, affecting outcomes. Researchers should quantify protein levels across systems using standardized Western blots or mass spectrometry.

  • Temporal Resolution Analysis: The timing of measurements can significantly impact results, especially for circadian-regulated genes like CAB2. Implementing high-temporal-resolution sampling (every 2-4 hours across 48-72 hours) can reveal patterns missed by single-timepoint analyses.

  • Statistical Modeling Approach:

    • Construct linear models followed by empirical Bayesian analysis

    • Account for time-of-day effects explicitly in statistical models

    • Use wavelet analysis to decompose time-series data into frequency components

  • Reconciliation Protocol: When discrepancies are observed, as in the case of HaRxL10's effect on CCA1 (which indirectly affects CAB2), researchers should:

    • Compare protein concentration levels across systems

    • Evaluate dose-response relationships

    • Consider indirect regulatory pathways that might be differentially activated in different systems

A specific example from the literature shows discrepancies between HaRxL10 overexpression plants and wild-type plants treated with Pst DC3000 TTSS-delivered HaRxL10. The difference in results was attributed to higher HaRxL10 protein levels in overexpression plants triggering more pronounced effects than the bacterial delivery system .

What are the most appropriate statistical methods for analyzing time-series data of CAB2 expression?

For robust analysis of CAB2 expression time-series data, the following statistical methods are recommended:

  • Periodicity Analysis:

    • Fast Fourier Transform (FFT) to identify dominant periodicities

    • MESA (Maximum Entropy Spectral Analysis) for shorter time series

    • JTK_CYCLE algorithm specifically optimized for circadian rhythm detection

  • Amplitude and Phase Determination:

    • Cosinor analysis to fit rhythmic data to cosine functions

    • Wavelet transforms to handle non-stationary signals

    • Phase vector analysis to compare phase relationships across multiple genes

  • Linear Modeling Framework:

    • Construct linear models followed by empirical Bayesian analysis to identify differentially expressed genes

    • Include time-of-day as an explicit factor in models

    • Apply mixed-effects models when combining data from multiple experiments

  • Visualization Techniques:

    • Actograms to visualize patterns across multiple days

    • Heat maps of expression levels across time points

    • Phase-sorted expression plots to identify co-regulated genes

When comparing CAB2 expression between genotypes (e.g., wild-type vs. mutant), both parametric (ANOVA with post-hoc tests) and non-parametric methods may be appropriate depending on data distribution characteristics.

How should researchers interpret changes in CAB2 period and amplitude in response to experimental treatments?

Interpreting changes in CAB2 expression parameters requires careful consideration of multiple factors:

  • Period Changes:

    • Shortened periods (as observed in HaRxL10 overexpression plants) typically indicate acceleration of the circadian clock

    • Period changes of less than 1 hour may be statistically significant but physiologically subtle

    • Consider whether period changes are consistent across multiple environmental conditions (light/dark, temperature cycles)

  • Amplitude Analysis:

    • Reduced amplitude (as seen with HaRxL10 overexpression) suggests dampened clock function or reduced coupling between clock and output pathways

    • Amplitude should be normalized to account for differences in baseline expression levels

    • Progressive amplitude reduction over multiple cycles may indicate system destabilization

  • Combined Parameter Assessment:

    • Create parameter relationship plots (period vs. amplitude) to identify patterns

    • Consider phase-amplitude coupling as an important regulatory feature

    • Evaluate whether period and amplitude changes correlate with physiological outcomes

  • Contextual Interpretation Framework:

    • Compare changes in CAB2 expression with other clock-regulated genes to determine specificity

    • Relate molecular findings to whole-plant phenotypes (growth, photosynthetic efficiency)

    • Consider whether changes represent compensation mechanisms or direct regulatory effects

For example, the observed shorter period and lower amplitude of CAB2 in HaRxL10 overexpression plants suggests this pathogen effector disrupts normal circadian function, potentially as a virulence strategy to compromise plant defense timing mechanisms.

What are the common challenges in purifying functional recombinant CAB2 protein and how can they be addressed?

Purifying functional recombinant CAB2 presents several challenges due to its chloroplast localization and chlorophyll-binding properties. Researchers can address these issues through the following methodological approaches:

  • Protein Aggregation Issues:

    • Challenge: CAB2's hydrophobic chlorophyll-binding domains often cause aggregation during expression and purification.

    • Solution: Incorporate 50% glycerol in storage buffers as specified for this protein . Additionally, use mild detergents (0.05-0.1% n-dodecyl β-D-maltoside) during extraction and purification steps.

  • Maintaining Native Conformation:

    • Challenge: Preserving the protein's ability to bind chlorophyll molecules.

    • Solution: Perform purification under dim green light conditions to prevent photooxidation, and consider co-expression with chlorophyll biosynthesis genes in appropriate expression systems.

  • Expression System Selection:

    • Challenge: Bacterial expression systems often produce misfolded membrane proteins.

    • Solution: Consider plant-based expression systems (Nicotiana benthamiana) or insect cell systems that provide appropriate post-translational modifications and membrane-protein processing machinery.

  • Protein Yield Optimization:

    • Challenge: Low yields of functional protein.

    • Solution: Optimize codon usage for the expression host, adjust induction conditions (temperature, duration), and explore fusion protein approaches (such as MBP or SUMO tags) that can enhance solubility.

  • Functional Verification Protocol:

    • Challenge: Confirming that purified protein retains native activity.

    • Solution: Implement chlorophyll-binding assays using absorption spectroscopy (monitoring characteristic absorption peaks at 646-663 nm) and circular dichroism to assess secondary structure integrity.

How can researchers address contradictory results when studying interactions between CAB2 and pathogen effectors?

When encountering contradictory results in CAB2-pathogen effector interaction studies, researchers should implement a systematic troubleshooting approach:

  • Expression Level Standardization:

    • Contradictory results often stem from different expression levels of effector proteins.

    • Solution: Quantify effector protein levels across experimental systems using quantitative Western blots or mass spectrometry, then normalize data accordingly. As observed with HaRxL10, higher effector concentrations in overexpression plants produced effects not seen in bacterial delivery systems .

  • Temporal Resolution Refinement:

    • Solution: Implement high-density time-course experiments (sampling every 2-4 hours) to capture transient or time-of-day-dependent effects that might be missed in endpoint analyses.

  • Multiple Interaction Pathway Analysis:

    • Solution: Consider both direct and indirect interaction pathways. For instance, HaRxL10 affects CAB2 expression through multiple mechanisms, including interaction with CHE (a CCA1 repressor) and potentially through direct interaction with CCA1 protein .

  • Biological Redundancy Assessment:

    • Solution: Test interactions in multiple genetic backgrounds, including single and higher-order mutants of related genes, to account for compensatory mechanisms that might mask effects in certain genetic backgrounds.

  • Cross-Validation Protocol:

    • Solution: Employ multiple independent techniques to verify interactions:

      • Yeast two-hybrid screening for protein-protein interactions

      • Co-immunoprecipitation from plant tissues

      • Bimolecular fluorescence complementation for in vivo interaction verification

      • ChIP-seq to identify direct transcriptional regulatory interactions

This systematic approach was effective in resolving apparent contradictions regarding HaRxL10's effects on circadian clock components, revealing that while direct effects on certain genes were not detected in some experimental systems, downstream effects on CAB2 expression remained consistent across systems .

How can CAB2 be utilized as a reporter for circadian rhythm disruption in plant-pathogen interaction studies?

CAB2 offers significant advantages as a reporter gene for studying circadian disruption during plant-pathogen interactions:

  • Reporter System Implementation:

    • Construct CAB2 promoter:luciferase fusion reporters to enable non-invasive, real-time monitoring of expression

    • Create stable transgenic lines carrying these reporters in various genetic backgrounds (wild-type, clock mutants, immunity-compromised)

    • Design complementary CAB2 promoter:GFP fusions for tissue-specific visualization of expression patterns

  • Pathogen Challenge Methodology:

    • Establish a standardized infection protocol with precise timing relative to circadian phases

    • Compare responses to virulent pathogens, avirulent strains, and purified effector proteins

    • Implement a time-course infection approach with sampling at 4-hour intervals over 48-72 hours

  • Data Collection Protocol:

    • Use automated luminescence imaging systems for continuous monitoring of CAB2:luciferase activity

    • Implement parallel qRT-PCR verification of endogenous CAB2 expression

    • Correlate changes in CAB2 rhythmicity with pathogen growth/reproduction metrics

  • Analytical Framework:

    • Apply wavelet transformation analysis to decompose temporal patterns

    • Employ machine learning algorithms to identify pattern disruptions that predict successful infection

    • Develop mathematical models integrating clock component interactions with defense signaling networks

Research has demonstrated that pathogen effectors like HaRxL10 can alter CAB2 expression patterns, with HaRxL10 overexpression plants displaying shorter periods and reduced amplitude of CAB2 expression. This indicates that pathogens may deliberately target the plant circadian system, potentially to optimize infection timing or suppress time-of-day-dependent defense responses .

What experimental designs are most effective for investigating CAB2's role in coordinating photosynthesis with circadian rhythms?

Investigating CAB2's role in coordinating photosynthesis with circadian rhythms requires sophisticated experimental designs:

  • Combined Time-Series and Factorial Design Approach:

    • Implement a Solomon four-group design (as described in experimental design literature) to control for testing effects

    • Establish experimental groups with combinations of:

      • Circadian entrainment conditions (light/dark cycles with different periods)

      • Photosynthetic light intensities

      • Genetic backgrounds (wild-type, clock mutants, CAB2 overexpression/knockdown)

    • Use counterbalanced designs to control for order effects when applying multiple treatments

  • Physiological Parameter Integration:

    • Simultaneously measure:

      • CAB2 expression (via qRT-PCR or reporter systems)

      • Photosynthetic efficiency (via chlorophyll fluorescence)

      • Carbon fixation rates (via gas exchange)

      • Metabolite profiles (via LC-MS or GC-MS)

    • Perform measurements at 2-hour intervals across 48-72 hours

  • Environmental Manipulation Protocol:

    • Subject plants to:

      • Free-running conditions (constant light or dark) to reveal endogenous rhythms

      • Phase shifts to assess clock resetting

      • Non-24-hour light/dark cycles to test entrainment limitations

      • Temperature perturbations to evaluate temperature compensation

  • Advanced Statistical Analysis Framework:

    • Apply regression-discontinuity analysis to identify threshold effects

    • Utilize equivalent time-samples design for statistical comparison

    • Implement structural equation modeling to test causal relationships between CAB2 expression, photosynthetic parameters, and growth metrics

This comprehensive approach enables researchers to distinguish between CAB2's direct effects on photosynthesis versus its role in circadian coordination, while controlling for confounding factors and experimental artifacts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.