Recombinant Glycine max Chlorophyll a-b binding protein 3, chloroplastic (CAB3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CAB3; Chlorophyll a-b binding protein 3, chloroplastic; LHCII type I CAB-3; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
34-263
Protein Length
Full Length of Mature Protein
Species
Glycine max (Soybean) (Glycine hispida)
Target Names
CAB3
Target Protein Sequence
RKTVTKQVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNR ELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQ SILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELK NGRLAMFSMFGFFVQAIVTGKGPLENLADHLAGPVNNNAWAYATNFVPGK
Uniprot No.

Target Background

Function
The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.
Database Links

STRING: 3847.GLYMA08G08770.2

UniGene: Gma.4593

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the role of Chlorophyll a-b Binding Protein 3 (CAB3) in soybean chloroplast development?

Chlorophyll a-b binding protein 3 (CAB3) serves as an essential component of the light-harvesting complex II (LHCII) in soybean chloroplasts. It functions primarily to bind chlorophyll molecules and transfer light energy to photosynthetic reaction centers. Research with chloroplast development mutants such as Gmpgl3-1 has demonstrated that proper expression and localization of chlorophyll-binding proteins is critical for thylakoid membrane organization and chloroplast development. Disruptions in the chlorophyll binding protein complex contribute to pale green leaf phenotypes, reduced photosynthetic efficiency, and decreased crop yields, similar to what has been observed in other chloroplast protein mutations .

How do mutations in genes related to chlorophyll binding affect soybean growth and development?

Mutations affecting chlorophyll binding and chloroplast development significantly impact soybean growth and productivity. In the Gmpgl3-1 mutant, which affects chloroplast development, researchers observed reduced plant height (by approximately 7%), decreased number of nodes (by 17.3%), and substantial reductions in yield parameters including pod number (reduced by 30.8%), grain number (reduced by 39.5%), and grain weight (reduced by 50.8%) . These phenotypic effects are directly linked to impaired photosynthetic capacity, as evidenced by decreased chlorophyll content and reduced photosynthetic rates (Pn reduced by 37.7%) . Similar physiological impacts would be expected in mutations affecting CAB3, given its critical role in photosynthetic light harvesting.

What techniques can be used to study subcellular localization of recombinant Glycine max CAB3 protein?

To determine the subcellular localization of recombinant Glycine max CAB3 protein, researchers can employ several approaches:

  • Fluorescent protein fusion analysis: Similar to the technique used with GmTic110a, researchers can create a CAB3-GFP fusion construct and transiently express it in plant protoplasts. Confocal microscopy can then be used to visualize the protein's localization pattern within the chloroplast .

  • Co-localization studies: Co-expression of CAB3-GFP with known chloroplast marker proteins (such as AtPIC1-mCherry for inner chloroplast membrane) allows for precise determination of the protein's sub-organellar localization through fluorescence overlap analysis .

  • Chloroplast fractionation: Biochemical fractionation of chloroplasts into thylakoid membrane, stroma, and envelope fractions, followed by western blot analysis using CAB3-specific antibodies.

  • Immunogold electron microscopy: For ultra-structural localization, immunogold labeling with CAB3-specific antibodies can provide nanometer-scale resolution of protein location within chloroplast subcompartments.

What are the most effective expression systems for producing functional recombinant Glycine max CAB3 protein?

The selection of an appropriate expression system for recombinant Glycine max CAB3 depends on the research objectives:

E. coli expression systems:

  • Advantages: Rapid growth, high protein yields, simple genetic manipulation

  • Limitations: Lack of post-translational modifications and proper folding of plant chloroplast proteins

  • Optimization: Use of specialized strains (e.g., BL21(DE3)), lower induction temperatures (16-20°C), and co-expression with chloroplast chaperones

Plant-based expression systems:

  • Advantages: Native-like post-translational modifications and protein folding environment

  • Options:

    • Transient expression in Nicotiana benthamiana using Agrobacterium-mediated transformation

    • Stable transformation in Arabidopsis thaliana as a model system

    • Homologous expression in soybean using methods like GmFAST (Fluorescence-Accumulating Seed Technology)

Cell-free expression systems:

  • Advantages: Rapid production, avoidance of toxicity issues, direct incorporation of labeled amino acids

  • Applications: Particularly valuable for structural studies requiring isotopic labeling

For functional studies, plant-based expression systems are generally preferred as they provide the native chloroplast environment necessary for proper CAB3 folding and pigment binding.

How can I optimize Agrobacterium-mediated transformation protocols specifically for recombinant CAB3 expression in soybean?

Optimizing Agrobacterium-mediated transformation for CAB3 expression in soybean requires attention to several key factors:

  • Vector design considerations:

    • Include a seed-specific promoter (such as the one used in GmFAST) for targeted expression

    • Incorporate a visual selection marker like OLE1-GFP for non-destructive screening

    • Consider using codon-optimized CAB3 sequences for enhanced expression

  • Transformation protocol optimization:

    • Target cotyledonary nodes of Glycine max cultivars with high regeneration capacity (e.g., Kariyutaka)

    • Optimize Agrobacterium strain (typically EHA101 or EHA105) and density (OD₆₀₀ = 0.6-0.8)

    • Implement a 5-day co-cultivation period at 22-24°C with 16/8 hour photoperiod

  • Selection strategy:

    • Implement the GmFAST method for visual selection of transformants using fluorescence microscopy

    • This approach can reduce required growing space by approximately 90% compared to conventional methods

    • Select the most strongly fluorescent T₂ seeds to identify homozygous lines

  • Verification methods:

    • Confirm integration using PCR and Southern blot analysis

    • Verify CAB3 expression levels through RT-qPCR and western blotting

    • Assess functionality through chlorophyll content and photosynthetic efficiency measurements

This optimized approach facilitates the generation of stable transgenic soybean lines expressing recombinant CAB3 while significantly reducing the resources required for screening.

What purification strategy yields the highest quality recombinant CAB3 protein while maintaining its native conformation?

A multi-step purification strategy optimized for chlorophyll-binding proteins is essential for obtaining high-quality recombinant CAB3:

  • Initial extraction:

    • Harvest young leaves or recombinant expression tissue

    • Homogenize in buffer containing 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 10% glycerol, 1 mM EDTA, and protease inhibitor cocktail

    • Include 0.5-1% mild detergent (n-dodecyl-β-D-maltoside or Triton X-100) to solubilize membrane-associated proteins

  • Thylakoid membrane isolation:

    • Perform differential centrifugation (1,000×g, 5,000×g, 40,000×g) to separate chloroplasts and thylakoid membranes

    • Wash isolated membranes with detergent-free buffer to remove loosely bound proteins

  • Affinity chromatography options:

    • For His-tagged constructs: Ni-NTA affinity chromatography under native conditions

    • For GST-fusion proteins: Glutathione sepharose chromatography

    • Native CAB3: Pigment-based affinity chromatography using immobilized chlorophyll derivatives

  • Size exclusion chromatography:

    • Further purify using gel filtration (Superdex 200) to separate monomeric protein from aggregates and light-harvesting complexes

    • Use buffer containing 25 mM HEPES (pH 7.5), 100 mM NaCl, and 0.03% n-dodecyl-β-D-maltoside

  • Quality assessment:

    • Evaluate protein purity by SDS-PAGE and western blotting

    • Confirm chlorophyll binding through absorption spectroscopy (characteristic peaks at 436 nm and 663 nm)

    • Verify native conformation using circular dichroism spectroscopy

This optimized purification protocol maintains the native conformation of CAB3 and its association with chlorophyll molecules, which is essential for functional studies.

How can I investigate protein-protein interactions between CAB3 and other chloroplast proteins in Glycine max?

Multiple complementary techniques can be employed to study the interactions between CAB3 and other chloroplast proteins:

  • Split luciferase complementation assays:

    • Similar to the approach used for GmTic110a interaction studies

    • Fuse CAB3 to the N-terminal fragment of luciferase and potential interacting partners to the C-terminal fragment

    • Co-express in tobacco leaves via Agrobacterium-mediated transformation

    • Measure reconstituted luciferase activity as an indicator of protein interaction

  • Co-immunoprecipitation (co-IP):

    • Generate antibodies against CAB3 or use epitope-tagged versions

    • Perform co-IP experiments using chloroplast extracts

    • Identify interacting partners through mass spectrometry analysis

    • Confirm specific interactions with known chloroplast proteins using western blotting

  • Yeast two-hybrid screening:

    • Construct a cDNA library from soybean leaf tissue

    • Use CAB3 as bait to screen for interacting proteins

    • Validate positive interactions through directed Y2H assays

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split YFP or GFP constructs fused to CAB3 and potential interacting partners

    • Visualize interactions in planta through confocal microscopy

    • Determine the subcellular localization of the interaction complexes

  • Proximity-based labeling:

    • Fuse CAB3 to BioID or TurboID biotin ligase

    • Express in soybean chloroplasts to biotinylate proteins in close proximity

    • Identify neighboring proteins using streptavidin pulldown and mass spectrometry

These approaches can reveal novel protein complexes involving CAB3 and provide insights into the functional organization of the light-harvesting machinery in soybean chloroplasts.

What phenotypic and functional assays can be used to characterize the impact of CAB3 mutations or overexpression in transgenic soybean?

Comprehensive characterization of CAB3 function requires multi-level analysis of transgenic plants:

Physiological and morphological assessments:

  • Plant height, internode number, and leaf size measurements

  • Chlorophyll content determination using spectrophotometric methods (similar to Gmpgl3 mutant analysis)

  • Fluorescence parameters (Fv/Fm) to assess photosystem II efficiency

  • Photosynthetic gas exchange measurements (photosynthetic rate, stomatal conductance, transpiration rate)

Ultrastructural analysis:

  • Transmission electron microscopy of chloroplasts to assess thylakoid membrane organization

  • Quantification of grana stacking and stroma thylakoid development

  • Comparison with wild-type and chloroplast development mutants (like Gmpgl3)

Molecular and biochemical characterization:

  • Quantitative analysis of photosynthetic pigments (chlorophyll a, chlorophyll b, carotenoids)

  • Protein composition analysis of thylakoid complexes using Blue Native PAGE

  • Immunoblot analysis of photosystem components and light-harvesting proteins

Field performance evaluation:

  • Seed yield parameters (pods per plant, seeds per pod, seed weight)

  • Environmental stress responses (high light, temperature fluctuations)

  • Growth rate and biomass accumulation under different light conditions

Omics approaches:

  • Transcriptomic profiling to identify downstream gene expression changes

  • Metabolomic analysis focusing on photosynthesis-related metabolites

  • Proteomic characterization of chloroplast protein complexes

ParameterWild TypeCAB3 MutantCAB3 Overexpression
Chlorophyll a content100%Reduced (similar to Gmpgl3 ~44% reduction)Potentially increased
Chlorophyll b content100%ReducedPotentially increased
Photosynthetic rate (Pn)100%Reduced (similar to Gmpgl3 ~38-51% reduction)Potentially enhanced
Thylakoid membrane organizationNormal grana stackingReduced thylakoids (similar to Gmpgl3)Enhanced grana formation
Plant height100%Potentially reduced (~7% as in Gmpgl3)Potentially increased
Seed yield100%Potentially reduced (~40-50% as in Gmpgl3)Potentially increased

These comprehensive assessments enable detailed characterization of CAB3's role in soybean photosynthesis and development.

How can I distinguish between the functions of different CAB protein family members in Glycine max?

Distinguishing the specific functions of CAB family members requires strategic approaches:

  • Phylogenetic and structural analysis:

    • Construct a phylogenetic tree of all Glycine max CAB family proteins

    • Analyze sequence conservation and divergence patterns

    • Identify specific domains or motifs unique to CAB3

    • Compare with characterized CAB proteins from model plants

  • Expression pattern analysis:

    • Perform tissue-specific and developmental stage-specific RT-qPCR for different CAB genes

    • Use promoter-reporter constructs to visualize expression patterns in planta

    • Analyze expression responses to different light qualities and intensities

    • Examine co-expression patterns with other photosynthesis-related genes

  • Targeted genetic approaches:

    • Generate CRISPR/Cas9 knockout lines specific to CAB3 and other family members

    • Create RNAi constructs targeting unique regions of specific CAB transcripts

    • Develop complementation lines expressing different CAB proteins in CAB3 mutant background

    • Apply the GmFAST system for efficient screening of transgenic lines

  • Protein-specific biochemical characterization:

    • Determine pigment binding specificities and stoichiometries for different CAB proteins

    • Analyze protein stability and turnover rates under different light conditions

    • Investigate post-translational modifications specific to different CAB family members

    • Characterize protein-protein interaction networks unique to each CAB protein

  • Functional complementation tests:

    • Express different CAB family members in the Gmpgl3 mutant background

    • Quantify the degree of phenotypic rescue for each complementation line

    • Determine if CAB3 can functionally replace other family members and vice versa

This multi-faceted approach enables precise characterization of the functional diversity within the CAB protein family in soybean.

What strategies can overcome the challenges of working with chloroplast membrane proteins like CAB3?

Working with chloroplast membrane proteins presents several unique challenges that require specialized approaches:

  • Solubilization challenges:

    • Challenge: CAB3 and other LHC proteins are embedded in the thylakoid membrane with hydrophobic domains

    • Solution: Optimize detergent type and concentration (n-dodecyl-β-D-maltoside at 0.5-1% typically works well)

    • Implementation: Screen multiple detergents (digitonin, Triton X-100) for optimal solubilization while maintaining native protein structure

  • Maintaining pigment association:

    • Challenge: Chlorophyll molecules easily dissociate during purification

    • Solution: Perform all procedures under dim green light at 4°C

    • Implementation: Add stabilizing agents like glycerol (10-15%) and avoid harsh pH conditions

  • Expression system limitations:

    • Challenge: Bacterial systems lack chlorophyll synthesis pathways

    • Solution: Use plant-based expression systems or reconstitution approaches

    • Implementation: Consider chloroplast transformation or the GmFAST system for targeted expression in soybean

  • Protein complex integrity:

    • Challenge: CAB3 functions as part of larger protein-pigment complexes

    • Solution: Employ gentle extraction methods that preserve native complexes

    • Implementation: Use blue native PAGE to analyze intact complexes followed by second-dimension SDS-PAGE

  • Functional assays:

    • Challenge: Assessing functionality requires appropriate pigment binding and energy transfer

    • Solution: Develop in vitro reconstitution assays with purified chlorophylls

    • Implementation: Measure chlorophyll fluorescence lifetime and energy transfer efficiency

These strategies significantly improve the success rate when working with recombinant CAB3 and other chloroplast membrane proteins.

How can I differentiate between the direct effects of CAB3 modification and secondary effects on chloroplast development?

Distinguishing primary from secondary effects requires a systematic approach:

  • Temporal analysis of phenotype development:

    • Monitor changes in gene expression, protein accumulation, and chloroplast structure during early leaf development

    • Establish a timeline of events following CAB3 modification

    • Compare with developmental timelines in chloroplast biogenesis mutants like Gmpgl3

  • Conditional expression systems:

    • Develop inducible CAB3 expression/silencing systems

    • Monitor immediate responses following induction

    • Distinguish early (likely direct) from late (likely secondary) effects

  • Targeted protein complex analysis:

    • Perform quantitative proteomics of isolated thylakoid complexes

    • Determine if CAB3 modification directly affects specific complex assembly

    • Compare with changes observed in other chloroplast protein mutants

  • Transcriptome analysis:

    • Identify immediate transcriptional responses to CAB3 modification

    • Apply network analysis to distinguish direct regulatory connections

    • Use time-course RNA-seq to separate primary and secondary transcriptional waves

  • Complementation studies with domain-specific mutations:

    • Engineer CAB3 variants with modifications to specific functional domains

    • Determine which domains are responsible for particular phenotypic effects

    • Create a domain-function map to separate different aspects of CAB3 function

TimepointDirect Effects of CAB3 ModificationSecondary Effects
0-6 hoursChanges in LHCII complex assemblyMinimal secondary effects
6-24 hoursAltered chlorophyll bindingEarly changes in photosynthetic efficiency
1-3 daysDisrupted energy transferAltered thylakoid organization
3-7 daysImpaired photoprotectionChloroplast developmental defects
>7 daysReduced plant growth and yield

This temporal separation enables researchers to focus on the primary molecular functions of CAB3 distinct from downstream developmental consequences.

What are the most reliable reference genes for RT-qPCR studies of CAB3 expression in different soybean tissues and developmental stages?

Selecting appropriate reference genes is critical for accurate RT-qPCR analysis of CAB3 expression:

Recommended reference genes for different experimental contexts:

  • For leaf tissue and photosynthesis-related studies:

    • GmELF1A (Elongation factor 1-alpha)

    • GmACT11 (Actin 11)

    • GmUKN1 (Unknown protein 1)

  • For developmental stage comparisons:

    • GmTUB4 (β-tubulin)

    • GmCYP2 (Cyclophilin)

    • GmUBC4 (Ubiquitin-conjugating enzyme E2)

  • For studies under abiotic stress conditions:

    • GmFBOX (F-box protein family)

    • GmELF1B (Elongation factor 1-beta)

    • GmGAPC (Glyceraldehyde-3-phosphate dehydrogenase C)

Validation approach:

Prior to CAB3 expression analysis, researchers should:

  • Test 6-8 candidate reference genes across all experimental conditions

  • Evaluate expression stability using multiple algorithms (geNorm, NormFinder, BestKeeper)

  • Select the 2-3 most stable reference genes for normalization

  • Calculate geometric means of multiple reference genes rather than relying on a single gene

Experimental design considerations:

  • Include at least three biological replicates per condition

  • Perform three technical replicates per biological sample

  • Design primers spanning exon-exon junctions to avoid genomic DNA amplification

  • Validate primer efficiency (90-110%) using standard curves

  • Include no-template and no-reverse-transcriptase controls

This systematic approach to reference gene selection significantly improves the reliability of CAB3 expression analysis across diverse experimental conditions.

How should I interpret contradictory results between in vitro and in vivo studies of recombinant CAB3 function?

Resolving contradictions between in vitro and in vivo findings requires systematic analysis:

  • Common sources of discrepancy:

    • In vitro conditions lack the complete chloroplast environment and protein interaction network

    • Recombinant proteins may have improper folding or missing post-translational modifications

    • Light conditions and pigment availability differ between systems

    • Concentration and stoichiometry of interacting partners vary between systems

  • Resolution strategies:

    • Bridge the gap with intermediate systems: Use isolated thylakoid membranes, chloroplast extracts, or protoplast systems that maintain more native conditions than purified components

    • Validate protein structure: Ensure recombinant CAB3 has the correct secondary structure using circular dichroism spectroscopy

    • Confirm pigment binding: Verify that recombinant CAB3 properly associates with chlorophyll molecules

    • Test concentration dependence: Examine whether discrepancies arise from non-physiological protein concentrations in vitro

  • Reconciliation approaches:

    • Design experiments that progressively increase system complexity from purified components to whole plants

    • Use multiple complementary techniques to examine the same interaction or function

    • Consider the possibility that both results are correct under their specific conditions

    • Develop mathematical models that account for the differences in experimental conditions

  • Case example from related research:

    • The GmTic110a protein was shown to interact with GmTic20, GmTic40a, and GmTic40b in vitro using split luciferase complementation and co-IP assays

    • These interactions were then confirmed in planta, demonstrating consistency between systems

    • Similar approaches can validate CAB3 interactions first identified in vitro

When properly analyzed, contradictory results often reveal important context-dependent aspects of protein function rather than experimental failures.

What are the most common technical problems when working with recombinant CAB3, and how can they be addressed?

Several technical challenges frequently arise when working with recombinant CAB3:

  • Low expression yields:

    • Problem: CAB3 expression levels are often low in heterologous systems

    • Solution: Optimize codon usage for the expression host; use strong, tissue-specific promoters like those in the GmFAST system

    • Implementation: Test multiple expression constructs with different promoters and terminators

  • Protein misfolding and aggregation:

    • Problem: Hydrophobic regions of CAB3 promote aggregation

    • Solution: Express at lower temperatures (16-20°C); include molecular chaperones

    • Implementation: Add 5-10% glycerol and non-ionic detergents to extraction buffers

  • Loss of chlorophyll binding:

    • Problem: Recombinant CAB3 often lacks bound chlorophyll

    • Solution: Perform reconstitution with purified chlorophyll in vitro

    • Implementation: Incubate purified protein with chlorophyll a and b at a 3:1 ratio in the presence of lipids

  • Antibody cross-reactivity:

    • Problem: Antibodies may cross-react with other CAB family members

    • Solution: Generate peptide antibodies against unique regions of CAB3

    • Implementation: Validate antibody specificity using knockout lines or recombinant proteins

  • Phenotyping variability:

    • Problem: Phenotypic effects of CAB3 modification may vary with environmental conditions

    • Solution: Conduct experiments under controlled light, temperature, and humidity

    • Implementation: Include appropriate wild-type and mutant controls (e.g., Gmpgl3) in all experiments

Technical ChallengeRoot CauseSolution StrategySuccess Indicator
Low expressionToxicity to hostInducible expression system>1 mg protein per liter culture
Protein aggregationHydrophobic domainsDetergent screening>80% protein in soluble fraction
Poor chlorophyll bindingImproper foldingIn vitro reconstitutionAbsorption peaks at 436 and 663 nm
Non-specific antibodiesSequence similarityPeptide-specific antibodiesSingle band on western blot
Inconsistent phenotypesEnvironmental variationControlled growth conditions<15% variation between replicates

These strategies significantly improve success rates in recombinant CAB3 research projects.

How can I determine if observed phenotypes in CAB3-modified plants are due to altered photosynthesis or secondary metabolic changes?

Distinguishing direct photosynthetic effects from secondary metabolic changes requires a multi-level analytical approach:

  • Immediate photosynthetic parameter analysis:

    • Measure chlorophyll fluorescence kinetics (OJIP transients) to assess electron transport efficiency

    • Perform P700 absorbance measurements to evaluate PSI activity

    • Quantify CO₂ assimilation rates under varying light intensities and CO₂ concentrations

    • Compare with similar measurements in chloroplast development mutants like Gmpgl3

  • Biochemical and metabolic profiling:

    • Conduct targeted analysis of primary photosynthetic metabolites (sugars, starch, ATP/ADP ratio)

    • Perform untargeted metabolomics to identify perturbed pathways

    • Compare metabolite profiles with transcript and protein changes

    • Look for metabolic signatures characteristic of specific stresses

  • Experimental manipulation approaches:

    • Grow plants under varying light conditions to modulate photosynthetic demand

    • Apply photosynthesis inhibitors to distinguish direct and indirect effects

    • Supplement with sugars to bypass photosynthetic limitations

    • Compare responses to those observed in plants with altered chloroplast development

  • Time-resolved analysis:

    • Conduct high-resolution time-course experiments after induction of CAB3 modification

    • Identify the temporal order of physiological and metabolic changes

    • Establish cause-effect relationships based on sequential changes

  • Correlation and network analysis:

    • Develop correlation networks between photosynthetic parameters and metabolic changes

    • Apply principal component analysis to identify primary drivers of phenotypic variation

    • Compare with published data from other photosynthetic mutants including Gmpgl3

Parameter TypeDirect Photosynthetic EffectSecondary Metabolic Effect
TimingImmediate (minutes to hours)Delayed (days)
Light dependenceStrong correlation with light intensityLess direct correlation
CO₂ responseAltered CO₂ response curvesNormal CO₂ response
Metabolic signatureChanges in Calvin cycle intermediatesBroader metabolic perturbation
Diurnal patternStrong diurnal fluctuationLess pronounced diurnal pattern

This systematic approach enables researchers to confidently attribute observed phenotypes to direct photosynthetic effects or secondary metabolic changes resulting from CAB3 modification.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.