Recombinant Glycine max Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life depends on various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cemA; ycf10; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Glycine max (Soybean) (Glycine hispida)
Target Names
cemA
Target Protein Sequence
MTKKKTFIPLLYLTSIVFLPWCISFTFKKSLESWFIDWWNTRQSEIFLNDIKEKSILKKF IEFEELFFLDDMLKECPETHLQNLRTGIYKETIQLIKTHNEDRMNTILHFSTNIICFFIL SGYSILGNQELVLINSLVREFIYNLSDTIKAFSILLLTDLCIGFHSTHGWELVIGFVYKD FGFAQNDQIISGLVSTFPVILDTILKYWIFRYLNRVSPSLVVIYHSMND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion. It indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Database Links
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the Glycine max Chloroplast envelope membrane protein (cemA)?

Chloroplast envelope membrane protein (cemA), also known as ycf10, is an integral membrane protein located in the chloroplast envelope of Glycine max (soybean). The protein consists of 229 amino acids and has multiple predicted transmembrane domains . CemA is part of the hydrophobic core of the chloroplast envelope membrane system, which separates the plastid stroma from the cytosol and controls the exchange of ions and metabolites between these compartments .

The complete amino acid sequence of cemA is:
MTKKKTFIPLLYLTSIVFLPWCISFTFKKSLESWFIDWWNTRQSEIFLNDIKEKSILKKFIEFEELFFLDDDMLKECPETHLQNLRTGIYKETIQLIKTHNEDRMNTILHFSTNIICRFILSGYSILGNQELVLINSLVREFIYNLSDTIKAFSILLLTDLCIGFHSTHGWELVIGFVYKDFGFAQNDQIISGLVSTFPVILDTILKYWIFRYLNRVSPSLVVIYHSMND

What is the structural characterization of cemA?

Based on structural prediction analysis, cemA contains multiple α-helical transmembrane domains typical of integral membrane proteins involved in transport functions . The protein's hydrophobic nature enables its integration into the lipid bilayer of the chloroplast envelope. Like many envelope membrane proteins, cemA likely exhibits a complex tertiary structure with hydrophobic regions spanning the membrane and hydrophilic domains extending into the aqueous environments on either side.

Experimental approaches for structural characterization typically involve purification in detergent micelles or reconstitution in nanodiscs, followed by techniques such as X-ray crystallography, cryo-electron microscopy, or nuclear magnetic resonance spectroscopy. The highly hydrophobic nature of cemA makes it amenable to extraction using chloroform/methanol (C/M) mixture (2:1, vol/vol), a common method for isolating integral membrane proteins for subsequent analysis .

How does cemA relate to other chloroplast envelope proteins?

CemA belongs to the family of chloroplast envelope membrane proteins, which constitute approximately 1-2% of total chloroplast proteins . These proteins remain one of the most elusive components of the chloroplast proteome due to their low abundance and hydrophobic nature .

Within the context of chloroplast function, cemA likely participates in the controlled exchange of metabolites and ions across the envelope membrane, which is crucial for integrating chloroplast metabolism with the rest of the plant cell . Comparative proteomic analyses have revealed that many envelope proteins, including cemA, share common features such as multiple transmembrane domains and specific targeting sequences that direct their localization to the chloroplast envelope .

What are the optimal methods for purifying recombinant cemA protein?

Purification of recombinant cemA requires specialized approaches due to its highly hydrophobic nature. The following methodological steps are recommended:

  • Expression System Selection: Use bacterial (E. coli) or eukaryotic (insect cell) expression systems with appropriate tags (such as His-tag) to facilitate purification .

  • Membrane Extraction: Extract the membrane fraction using ultracentrifugation followed by solubilization with mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin to maintain protein structure and function.

  • Organic Solvent Extraction: Apply chloroform/methanol (2:1, vol/vol) extraction to isolate the highly hydrophobic fraction containing cemA. This approach involves:

    • Diluting envelope membrane preparations (0.5 mg protein in 0.1 ml buffer) in 0.9 ml cold C/M solution

    • Incubating on ice for 15 minutes

    • Centrifuging at 12,000 × g for 20 minutes at 4°C

    • Collecting the organic phase containing solubilized membrane proteins

  • Chromatographic Separation: Perform affinity chromatography using the tag system, followed by size exclusion chromatography to remove aggregates and obtain pure protein.

  • Quality Assessment: Verify protein purity using SDS-PAGE and Western blotting with antibodies specific to cemA or its tag .

How can researchers effectively verify the subcellular localization of cemA?

Verification of cemA's subcellular localization can be approached through several complementary methods:

  • Subcellular Fractionation and Western Blotting:

    • Isolate chloroplasts from plant tissue using Percoll gradient centrifugation

    • Further fractionate chloroplasts to separate envelope membranes from thylakoids and stroma

    • Perform Western blotting using specific antibodies against cemA

    • Include appropriate markers for different compartments:

      • HMA1 as an envelope marker

      • LHCP as a thylakoid marker

      • KARI as a stromal marker

      • BiP as an ER marker

      • V-ATPase as a tonoplast marker

  • Fluorescent Protein Fusion and Confocal Microscopy:

    • Generate constructs expressing cemA fused to fluorescent proteins (GFP, YFP)

    • Transform plants or protoplasts

    • Visualize localization using confocal microscopy

    • Co-localize with known organelle markers

  • Immunogold Electron Microscopy:

    • Prepare plant tissue sections for electron microscopy

    • Label with cemA-specific antibodies followed by gold-conjugated secondary antibodies

    • Quantify gold particle distribution across different membrane systems

  • Proteomic Approach with Enrichment Factor Calculation:

    • Compare proteomes of total leaf extract and purified chloroplast envelope fractions

    • Calculate the Enrichment Factor for cemA to confirm its genuine envelope localization versus potential contamination

What experimental approaches are recommended for studying cemA transport function?

Investigating the transport function of cemA requires specialized experimental setups:

  • Liposome Reconstitution Assays:

    • Purify recombinant cemA protein

    • Reconstitute into liposomes of defined lipid composition

    • Measure transport of putative substrates across the liposomal membrane using:

      • Radioisotope-labeled substrates

      • Fluorescent probes

      • Ion-selective electrodes

  • Electrophysiological Methods:

    • Reconstitute cemA in planar lipid bilayers or patch-clamp compatible systems

    • Measure ion currents under various conditions

    • Test substrate specificity by modifying the composition of bath solutions

  • CRISPR-Cas9 Knockout and Complementation Studies:

    • Generate cemA knockout lines in Glycine max or model systems

    • Perform metabolic profiling to identify accumulated or depleted metabolites

    • Conduct complementation studies with wildtype or mutated versions of cemA

    • Analyze growth phenotypes under various conditions to infer function

  • Transport Assays in Isolated Chloroplasts:

    • Isolate intact chloroplasts from wildtype and cemA-modified plants

    • Measure uptake and efflux of potential substrates (ions, metabolites)

    • Compare transport kinetics parameters (Km, Vmax) to characterize specificity

How can protein-protein interactions of cemA be effectively studied?

Understanding cemA's interactions with other proteins requires multiple complementary approaches:

  • Split-Ubiquitin Yeast Two-Hybrid System (specifically designed for membrane proteins):

    • Clone cemA as a bait protein

    • Screen against a library of chloroplast proteins

    • Verify positive interactions through additional methods

  • Co-Immunoprecipitation from Chloroplast Membranes:

    • Solubilize chloroplast membranes with mild detergents

    • Perform pull-down assays using cemA-specific antibodies

    • Identify interacting partners by mass spectrometry

    • Validate specific interactions by reciprocal co-IP

  • Proximity-Based Labeling:

    • Generate fusion proteins of cemA with BioID or APEX2

    • Express in plant systems and activate labeling

    • Purify biotinylated proteins using streptavidin

    • Identify labeled proximal proteins by mass spectrometry

  • Förster Resonance Energy Transfer (FRET) or Bimolecular Fluorescence Complementation (BiFC):

    • Create fluorescent protein fusions with cemA and candidate interactors

    • Express in plant protoplasts or leaves

    • Analyze protein interactions by fluorescence microscopy

How should mass spectrometry data for cemA identification be analyzed?

Mass spectrometry data analysis for cemA identification and characterization should follow these methodological steps:

  • Database Preparation:

    • Utilize protein, expressed sequence tag (EST), and genomic plant databases

    • Develop or implement BLAST-based programs for processing MS/MS data

  • Peptide Identification Parameters:

    • Set appropriate false discovery rate thresholds (typically <1%)

    • Consider post-translational modifications common in chloroplast proteins

    • Account for the hydrophobic nature of cemA peptides which may be underrepresented

  • Verification Criteria:

    • Require multiple unique peptide matches

    • Examine the distribution of identified peptides across the protein sequence

    • Analyze the hydrophobic regions coverage, which is typically challenging for transmembrane domains

  • Quantitative Analysis:

    • Calculate the Enrichment Factor by comparing abundance in envelope fractions versus total leaf extracts

    • Use this parameter to distinguish genuine envelope components from contaminants

    • Implement statistical validation to assess significance of identification

What bioinformatic approaches can predict cemA function from sequence data?

Several bioinformatic approaches can provide insights into cemA function:

  • Transmembrane Domain Prediction:

    • Apply multiple algorithms (TMHMM, Phobius, MEMSAT) to identify membrane-spanning regions

    • Create a consensus prediction to improve accuracy

    • Analyze the topology and orientation of transmembrane helices

  • Conserved Domain Analysis:

    • Search for functional domains using InterPro, Pfam, and PROSITE databases

    • Identify conserved motifs associated with specific transport functions

    • Compare with characterized transporters in other organisms

  • Phylogenetic Analysis:

    • Construct phylogenetic trees using cemA homologs from diverse species

    • Identify evolutionary relationships with proteins of known function

    • Infer potential function based on evolutionary proximity to characterized proteins

  • Structural Modeling:

    • Generate 3D structural models using homology modeling or ab initio approaches

    • Identify potential substrate binding sites or channel-forming regions

    • Perform molecular dynamics simulations to predict functional mechanisms

  • Co-expression Network Analysis:

    • Analyze transcriptomic data to identify genes co-expressed with cemA

    • Map co-expressed genes onto metabolic pathways to predict functional context

    • Integrate with protein-protein interaction data to build functional networks

What are the main technical challenges in cemA research?

Research on cemA faces several significant technical challenges:

  • Protein Abundance Limitations:

    • Chloroplast envelope proteins constitute only 1-2% of total chloroplast proteins, making them inherently difficult to isolate in sufficient quantities

    • The low abundance necessitates highly sensitive detection methods and effective enrichment strategies

  • Hydrophobicity Challenges:

    • The multiple transmembrane domains of cemA create solubility issues during extraction and purification

    • Standard proteomic workflows may fail to efficiently recover highly hydrophobic peptides

    • Special extraction methods using organic solvents are required

  • Functional Assay Development:

    • Establishing reliable assays to measure transport activity requires identification of substrate specificity

    • Reconstitution into artificial membrane systems while maintaining function is technically demanding

    • Distinguishing direct transport from indirect effects requires careful experimental design

  • Structural Determination:

    • Membrane proteins are notoriously difficult for structural studies

    • Crystallization often fails due to conformational heterogeneity

    • Detergent selection critically impacts structural integrity

How can integrative approaches advance our understanding of cemA function?

Advancing cemA research requires integration of multiple experimental and computational approaches:

  • Multi-omics Integration:

    • Combine proteomics, transcriptomics, and metabolomics data

    • Correlate cemA expression with metabolic profiles under various conditions

    • Identify potential regulatory networks and metabolic pathways affected by cemA

  • Systems Biology Modeling:

    • Develop mathematical models of chloroplast membrane transport

    • Incorporate cemA function into whole-cell metabolic models

    • Simulate the impact of cemA modifications on plant metabolic flux

  • Comparative Studies Across Species:

    • Analyze cemA homologs from diverse plant species

    • Compare functional characteristics in C3, C4, and CAM photosynthetic systems

    • Identify evolutionary adaptations in cemA structure related to specific environmental conditions

  • Advanced Imaging Techniques:

    • Apply super-resolution microscopy to study cemA distribution

    • Use single-molecule tracking to analyze cemA dynamics within the membrane

    • Combine with functional probes to correlate localization with activity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.