Recombinant Glycine max Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Glycine max Cytochrome b6-f complex subunit 4 (petD) is a protein component of the cytochrome b6-f complex, which is essential for photosynthetic electron transport in plants and algae . The cytochrome b6-f complex mediates electron transfer between Photosystem II and Photosystem I, contributing to the generation of a proton gradient that drives ATP synthesis . Subunit 4 (petD), is a smaller subunit of this complex that plays a critical role in its catalytic activity and stability .

Characteristics

CharacteristicDescription
SynonymsCytochrome b6-f complex subunit 4; 17 kDa polypeptide
SourceE. coli
SpeciesGlycine max (soybean)
Molecular Weight~17 kDa
TagHis
PurityGreater than 90% as determined by SDS-PAGE
FormLyophilized powder
AA SequenceMSVTKKPDLTDPVLKEKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTFACVIGLSVLDPA AIGEPANPFATPLEILPEWYFYPVFQLLRTVPNKLLGVLLMAAVPAGLITVPFIENINKF QNPYRRPIATTLFLVGTLVAVWLGIGATLPIEISLTFGLF
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles . Store working aliquots at 4°C for up to one week .
ReconstitutionReconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ .

Function and Catalytic Role

Subunit IV, a protein with a molecular weight of 17,000 Da, plays a crucial role in the chloroplast cytochrome b6-f complex . Research has demonstrated that the activity of the cytochrome b6-f complex decreases with the increase of trypsin incubation time, with a maximal inactivation of 80% reached at 7 minutes of incubation. This inactivation is accompanied by the destruction of the proton translocation activity of the complex .

Research Findings

  • Trypsinolysis Studies :

    • The catalytic role of subunit IV in the chloroplast cytochrome b6-f complex has been confirmed through trypsinolysis experiments.

    • Trypsin inactivation correlates with the digestion of subunit IV, specifically at a cleavage site around lysine 119 or arginine 125/126, resulting in a residual molecular mass of approximately 14 kDa.

  • Activity and Sensitivity :

    • The activity of the cytochrome b6-f complex is low in thylakoid membranes but significantly increases upon sonication, also increasing sensitivity to trypsinolysis.

Applications

Recombinant Glycine max Cytochrome b6-f complex subunit 4 (petD) is used in various research applications:

  • Studying photosynthetic electron transport mechanisms.

  • Analyzing the structure and function of the cytochrome b6-f complex.

  • Investigating the regulation of photosynthetic efficiency in plants.

  • As a reference protein in biochemical assays and experiments .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Glycine max (Soybean) (Glycine hispida)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPTGLLTVPFLENVNKF QNPFRRPVATTIFLIGTVVALWLGIGATLPIEKSLTLGLF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links

KEGG: gmx:3989328

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of the petD protein in the Cytochrome b6-f complex?

PetD is a critical subunit of the Cytochrome b6-f complex that plays a fundamental role in the assembly and stabilization of the entire complex. Research indicates that PetD forms a mildly protease-resistant subcomplex with Cytochrome b6 that serves as a structural template for the assembly of other components including Cytochrome f and PetG, ultimately producing a protease-resistant cytochrome moiety . The proper association of PetD with Cytochrome b6 is a prerequisite for the synthesis and stability of Cytochrome f, highlighting its importance in the sequential assembly of the functional complex .

How does the absence of petD affect the Cytochrome b6-f complex in Glycine max?

When PetD is inactivated or absent in Glycine max, the synthesis of Cytochrome f is greatly reduced, indicating that PetD is essential for the proper formation of the complex . Pulse-labeling experiments have demonstrated that in mutants lacking proper PetD function (such as in the dac mutant), the rate of labeling of Cytochrome b6-f subunits Cytochrome f and PetD was substantially reduced compared to wild-type plants, while the synthesis of Cytochrome b6 remained unaffected after 30 minutes of pulse labeling . This demonstrates the hierarchical dependency in the assembly process of the complex, with PetD playing a pivotal role in maintaining the stability and proper formation of the entire Cytochrome b6-f complex.

What techniques are used to express recombinant petD from Glycine max?

The expression of recombinant petD from Glycine max typically involves several key techniques:

  • Gene isolation and amplification using PCR with specific primers designed for the petD sequence

  • Cloning of the amplified fragment into an appropriate expression vector

  • Transformation into a suitable expression system (bacterial, yeast, or plant-based)

  • Verification of successful transformation through molecular techniques

For expression in plants, the Fluorescence-Accumulating Seed Technology (GmFAST) can be utilized, which employs a marker composed of a soybean seed-specific promoter coupled to a reporter gene . This approach allows for visual screening of successful transformants. Specifically, the introduction of the construct into cotyledonary nodes of Glycine max has been demonstrated as an effective method .

How can researchers optimize the cloning strategy for recombinant Glycine max petD expression?

Optimizing the cloning strategy for recombinant Glycine max petD expression requires careful consideration of several factors:

  • Promoter selection: Using a strong, tissue-specific promoter such as the Glycine max 11S globulin (GLYCININ) promoter (proGm11S) can enhance expression in specific tissues .

  • Restriction enzyme selection: Strategic use of restriction enzymes that do not cut within the petD sequence is crucial. For example, enzymes like HindIII and XbaI have been successfully used to manipulate promoter sequences in Glycine max recombinant systems .

  • Use of In-Fusion cloning systems: This approach allows for directional cloning without reliance on restriction enzyme sites within the sequence of interest, which can be particularly valuable for maintaining the integrity of the petD coding sequence .

What are the critical considerations in designing purification protocols for recombinant petD protein?

Purification of recombinant petD protein requires addressing several critical considerations:

  • Membrane protein handling: As petD is a membrane protein component of the Cytochrome b6-f complex, standard purification approaches must be modified to accommodate its hydrophobic nature.

  • Detergent selection: Appropriate detergents must be selected to solubilize the protein without denaturing its structure.

  • Affinity tag positioning: Tags should be positioned to avoid interference with protein folding or function, with C-terminal tags often preferred to minimize impact on membrane protein insertion.

  • Quality control steps: Verification of proper folding and assembly through analytical techniques such as circular dichroism or limited proteolysis should be incorporated.

  • Functional validation: Activity assays specific to petD function should be established to confirm that the purified protein retains its native characteristics.

For plant-based expression systems, protocols must include careful tissue homogenization steps followed by differential centrifugation to isolate membrane fractions before detergent solubilization .

How can researchers validate that recombinant petD properly interacts with other components of the Cytochrome b6-f complex?

Validation of proper interactions between recombinant petD and other Cytochrome b6-f complex components requires multiple complementary approaches:

  • Co-immunoprecipitation studies: Using antibodies specific to petD or other complex components to pull down interaction partners and analyze by immunoblotting.

  • In vitro reconstitution assays: Combining purified recombinant petD with other purified components to assess complex formation.

  • Radioactive pulse-labeling: This approach can monitor the assembly process in real-time, revealing the sequential incorporation of components into the complex .

  • Functional complementation: Introducing the recombinant petD into mutant plants lacking functional petD to assess restoration of complex activity and stability.

  • Fluorescence resonance energy transfer (FRET): If fluorescently tagged versions of the proteins can be generated, FRET can be used to monitor protein-protein interactions in real-time.

Research has shown that in the absence of petD, the stability of other components like Cytochrome f is compromised, providing a clear readout for successful interaction studies .

What PCR conditions are optimal for amplifying the petD gene from Glycine max?

The optimal PCR conditions for amplifying the petD gene from Glycine max involve:

  • DNA extraction: High-quality genomic DNA should be isolated using commercial kits like the DNeasy plant mini kit (Qiagen) following manufacturer's instructions .

  • Primer design: Primers should be designed with the following considerations:

    • Include appropriate restriction sites for subsequent cloning

    • Ensure specificity to the petD sequence

    • Optimal annealing temperatures between 55-60°C

    • GC content between 40-60%

  • Polymerase selection: High-fidelity DNA polymerases such as MightyAmp DNA polymerase (TaKaRa) are recommended for accurate amplification .

  • Verification: Gel electrophoresis to confirm the correct size of the amplified product followed by sequencing to verify the accuracy of the amplification.

What expression systems are most effective for producing functional recombinant petD protein?

Different expression systems offer distinct advantages for producing functional recombinant petD protein:

Expression SystemAdvantagesLimitationsRecommended for petD
E. coliFast growth, high yield, simple cultivationLimited post-translational modifications, inclusion body formationInitial screening, structural studies
Yeast (P. pastoris)Eukaryotic processing, high density cultureMedium complexity, lower yields than bacteriaFunctional studies requiring folding
Plant expression (N. benthamiana)Native-like processing, appropriate redox environmentLower yields, longer production timeFunctional studies, interaction studies
Glycine max transformationMost native environmentComplex, time-consumingIn vivo functional studies

How can researchers troubleshoot low expression yields of recombinant petD?

When troubleshooting low expression yields of recombinant petD, researchers should consider:

  • Codon optimization: Adapting the coding sequence to the preferred codon usage of the expression host can significantly improve translation efficiency.

  • Expression temperature modulation: Lowering the expression temperature (e.g., from 37°C to 16-20°C for bacterial systems) can improve proper folding and reduce aggregation.

  • Induction optimization: Testing different inducer concentrations and induction times to identify optimal conditions.

  • Fusion partners: Testing various fusion tags that can enhance solubility, such as MBP (maltose-binding protein) or SUMO.

  • Cell-free expression systems: For particularly challenging membrane proteins like petD, cell-free systems with added lipids or detergents can be effective alternatives.

  • Promoter strength: If using plant expression systems, comparing different promoters such as the Glycine max 11S globulin promoter with alternatives to identify optimal expression levels .

  • RNA stability assessment: Analyzing mRNA levels to determine if the issue lies at the transcriptional or translational level.

How can researchers distinguish between genuine petD function and artifacts in recombinant expression studies?

Distinguishing between genuine petD function and artifacts in recombinant expression studies requires multiple controls and validation approaches:

  • Comparison with wild-type protein: Always include the native protein from Glycine max as a positive control when assessing function.

  • Multiple expression systems: Test the protein in different expression systems to identify system-specific artifacts.

  • Structure-function analysis: Create targeted mutations in known functional domains and assess the impact on activity to validate that observed functions correlate with structural elements.

  • Complementation studies: Test whether the recombinant protein can restore function in plants with mutations in the endogenous petD gene .

  • Negative controls: Include closely related but functionally distinct proteins to demonstrate specificity of observed functions.

  • Dose-response relationships: Genuine functions typically show characteristic dose-response relationships that artifacts may not replicate.

  • Correlation with in vivo data: Validate findings by comparing with in vivo studies in Glycine max.

  • Technical replicates and biological replicates: Ensure reproducibility across multiple protein preparations and experimental runs.

What statistical approaches are most appropriate for analyzing changes in Cytochrome b6-f complex assembly when working with recombinant petD?

When analyzing changes in Cytochrome b6-f complex assembly with recombinant petD, the following statistical approaches are most appropriate:

  • For pulse-chase experiments:

    • Repeated measures ANOVA for time-course data

    • Area under the curve (AUC) analysis for integration of signal over time

    • Calculation of half-lives (t½) for different complex components

  • For quantitative proteomics:

    • Student's t-test for pairwise comparisons between experimental conditions

    • ANOVA with post-hoc tests for multi-condition comparisons

    • Principal component analysis (PCA) to identify patterns across multiple protein changes

  • For functional assays:

    • Non-linear regression for enzyme kinetics analysis

    • Normalization to reference proteins to account for expression level differences

    • Statistical power analysis to determine appropriate sample sizes

  • For microscopy-based colocalization:

    • Pearson's correlation coefficient

    • Manders' overlap coefficient

    • Costes randomization for statistical validation

Data should be presented with appropriate error bars representing standard deviation or standard error of the mean, with clear indication of sample sizes and statistical significance thresholds .

How should researchers approach contradictory results between in vitro recombinant petD studies and in vivo observations?

When faced with contradictory results between in vitro recombinant petD studies and in vivo observations, researchers should:

  • Systematically compare experimental conditions:

    • Buffer compositions

    • Presence of specific cofactors

    • Redox conditions

    • Protein concentrations

    • Temperature and pH differences

  • Evaluate protein modifications:

    • Post-translational modifications present in vivo but absent in recombinant systems

    • Presence/absence of interacting partners

    • Membrane environment differences

  • Consider methodological limitations:

    • Sensitivity and specificity of detection methods

    • Temporal resolution of measurements

    • Spatial resolution in localization studies

  • Design bridging experiments:

    • Cell-free translation systems using plant extracts

    • Microsomal preparations

    • Isolated chloroplast studies

    • Reconstitution of purified components in liposomes

  • Apply complementary techniques:

    • If contradictions exist in functional data, obtain structural information

    • If structural data is contradictory, perform detailed functional mapping

    • Use genetic approaches to validate biochemical findings

Research has shown that the synthesis of Cytochrome f is greatly reduced when either Cytochrome b6 or petD is inactivated, indicating the interdependence of these components. This relationship should be considered when interpreting contradictory results, as the absence of one component may have cascading effects on the assembly and function of the entire complex .

What opportunities exist for improving recombinant Glycine max petD expression using new synthetic biology approaches?

Emerging synthetic biology approaches offer several opportunities for improving recombinant Glycine max petD expression:

  • CRISPR/Cas9 genome editing: Precise modification of the native petD locus to introduce tags or regulatory elements without disrupting endogenous function.

  • Synthetic promoter design: Development of tailored promoters with optimized strength and regulation for petD expression, building upon established promoters like the Glycine max 11S globulin promoter .

  • RNA-based tools: Incorporation of specific RNA structural elements to enhance mRNA stability and translation efficiency.

  • Modular cloning systems: Implementation of standardized assembly methods like Golden Gate or Gibson Assembly for rapid testing of different expression constructs.

  • Cell-free protein synthesis optimization: Development of Glycine max-derived cell-free systems specifically optimized for membrane protein expression.

  • Minimal genome hosts: Engineering of simplified expression hosts with reduced proteolytic activity and optimized membrane protein folding machinery.

  • Directed evolution approaches: Development of high-throughput screening systems to evolve variants of petD with enhanced expression characteristics while maintaining function.

Researchers have already demonstrated success with technologies like Fluorescence-Accumulating Seed Technology (GmFAST) for transgenic soybean selection, indicating the potential for similar innovations specific to petD expression .

How might integrating structural biology approaches enhance our understanding of recombinant petD in the context of the Cytochrome b6-f complex?

Integrating structural biology approaches can significantly enhance our understanding of recombinant petD in several ways:

  • Cryo-electron microscopy (cryo-EM):

    • Determination of the structure of the entire Cytochrome b6-f complex with recombinant components

    • Visualization of different assembly intermediates to understand the role of petD in complex formation

    • Comparison between wild-type and recombinant structures to identify any conformational differences

  • X-ray crystallography:

    • High-resolution structural determination of petD alone or in subcomplex with Cytochrome b6

    • Mapping of interaction interfaces with other complex components

    • Co-crystallization with inhibitors or substrates to understand functional aspects

  • Nuclear magnetic resonance (NMR):

    • Analysis of dynamics and flexibility of specific domains within petD

    • Investigation of membrane interactions in a native-like environment

    • Study of protein-protein interactions in solution

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Mapping of solvent accessibility changes upon complex formation

    • Identification of conformational changes in different functional states

    • Assessment of structural impact of mutations or post-translational modifications

  • Cross-linking mass spectrometry (XL-MS):

    • Verification of proximity relationships between petD and other complex components

    • Validation of structural models derived from other techniques

    • Identification of transient interactions not captured by other methods

Understanding the structural basis of how petD forms a protease-resistant subcomplex with Cytochrome b6 would provide critical insights into the assembly process of the entire Cytochrome b6-f complex .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.