Recombinant Glycine max Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant production involves cloning the petB gene into expression vectors, followed by transfection into host systems. For example:

  • Expression: Optimized codon usage for E. coli or eukaryotic systems to enhance yield .

  • Purification: Affinity chromatography (e.g., His-tag systems) and gel filtration to isolate functional monomers .

  • Reconstitution: Requires addition of glycerol (5–50%) for stability and prevention of aggregation .

Challenges include ensuring proper heme incorporation, which depends on accessory proteins like the CCB (cofactor assembly) pathway in chloroplasts .

Role in Photosynthesis

  • Electron Transport: Facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI) .

  • Proton Gradient Formation: Enables ATP synthesis by contributing to the proton motive force .

Experimental Use Cases

  • Mutagenesis Studies: Site-directed mutations (e.g., Pro204Leu in Chlamydomonas) reveal residues critical for cyt b6f assembly .

  • Complex Assembly Analysis: Used to study interactions with Rieske FeS (PetC) and subunit IV (PetD) .

  • Biophysical Characterization: Stopped-flow spectroscopy and cryo-EM resolve electron transfer kinetics and dimeric structure .

Comparative Insights from Homologs

Studies on homologs in Arabidopsis, Chlamydomonas, and cyanobacteria provide indirect insights:

  • Overexpression Effects: Elevated cyt b6 levels correlate with increased PSI/PSII efficiency and biomass yield .

  • Structural Conservation: Cryo-EM structures show dimeric organization with edge-to-edge heme distances of 10–12 Å, conserved across species .

Challenges and Considerations

  • Heme Integration: Requires co-expression with CCB proteins (e.g., CCB1, CCB2) for covalent heme attachment .

  • Stability Issues: Repeated freeze-thaw cycles degrade activity; lyophilization with trehalose improves longevity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Glycine max (Soybean) (Glycine hispida)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSSLVELLRGSSSVGQSTL TRFYSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6, a component of the cytochrome b6-f complex, plays a crucial role in mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the functional significance of Cytochrome b6 (petB) in Glycine max photosynthesis?

Cytochrome b6 (PetB) functions as a core subunit of the cytochrome b6f complex, which serves as a crucial intermediary in the photosynthetic electron transport chain between Photosystem II and Photosystem I. In all vascular plants including Glycine max, cytochrome b6 (PetB) and subunit IV (PetD) are encoded by the last two genes of a large polycistronic unit . This complex plays a pivotal role in:

  • Facilitating electron transfer from plastoquinol to plastocyanin

  • Contributing to proton translocation across the thylakoid membrane for ATP synthesis

  • Serving as a major control point for photosynthetic electron flux regulation

Research methodologies for studying this function include spectroscopic analyses of electron transport rates, measurements of proton motive force generation, and comparative analysis of mutant phenotypes with altered cytochrome b6 expression.

How is the petB gene organized in the Glycine max chloroplast genome?

In Glycine max, as in other vascular plants, the petB gene encoding cytochrome b6 is located in the chloroplast genome as part of a polycistronic transcriptional unit . To characterize this organization:

  • Perform whole chloroplast genome sequencing using next-generation sequencing methods

  • Conduct transcriptome analysis to identify the polycistronic message containing petB

  • Use 5' and 3' RACE (Rapid Amplification of cDNA Ends) to precisely map transcript boundaries

  • Employ Northern blot analysis to visualize processing intermediates

Understanding this genomic organization is critical because it influences expression regulation and post-transcriptional processing of the petB gene product.

What expression systems are most effective for producing recombinant Glycine max cytochrome b6?

Based on established methodologies for recombinant membrane proteins, several expression systems can be employed:

Expression SystemAdvantagesLimitationsYield (Typical)
E. coliRapid growth, easy genetic manipulationMay lack proper folding of plant membrane proteins0.5-5 mg/L
Yeast (P. pastoris)Eukaryotic processing, higher yieldsLonger expression time5-20 mg/L
Plant cell-based systemsNative-like folding and processingSlower growth, lower yields0.1-1 mg/L
Insect cellsGood for membrane proteinsMore complex methodology1-10 mg/L

For recombinant protein production, an approach similar to that used for other plant proteins can be applied, where the expression of the target gene is induced in E. coli followed by protein purification and activity assays . When working with cytochrome b6, it's essential to optimize codon usage for the host system and include appropriate cofactor supplementation (heme) in the growth medium.

What are the key structural features of Glycine max cytochrome b6 that must be preserved in recombinant forms?

When producing recombinant cytochrome b6, preserving these structural features is critical:

  • Heme binding sites: Two b-type hemes (b6L and b6H) must be correctly incorporated

  • Transmembrane helices: Four transmembrane spans must maintain proper orientation

  • Protein-protein interaction surfaces: Interfaces for interaction with other subunits of the cytochrome b6f complex

  • Plastoquinone binding sites: The Qp (positive) and Qn (negative) sites for substrate binding

Methods to verify structural integrity include:

  • Absorption spectroscopy to confirm proper heme incorporation

  • Circular dichroism to assess secondary structure

  • Functional reconstitution assays to verify electron transport capability

  • Limited proteolysis to probe proper folding

How does environmental stress affect the stoichiometry of cytochrome b6f complex in Glycine max?

Environmental stresses trigger significant stoichiometric adjustments in the photosynthetic complexes of higher plants, including Glycine max. The cytochrome b6f complex content is dynamically regulated in response to changing environmental conditions and metabolic states . To investigate these changes:

  • Expose plants to controlled stress conditions (drought, high light, temperature extremes)

  • Quantify changes in cytochrome b6f complex abundance using:

    • Western blotting with antibodies against PetB

    • Blue-native PAGE to visualize intact complexes

    • Quantitative proteomics using labeled peptides as standards

  • Correlate complex abundance with photosynthetic parameters:

    • Electron transport rates

    • Photosynthetic control by lumen acidification

    • Linear versus cyclic electron flow

Research demonstrates that cytochrome b6f content closely correlates with linear electron flux and leaf assimilation capacity, suggesting its role as a predominant point of photosynthetic flux control . Under stress conditions, maintaining the proper balance between proton influx (controlled by cytochrome b6f) and proton efflux (through ATP synthase) is critical for photosynthetic adaptation.

What are the kinetic parameters of recombinant Glycine max cytochrome b6 compared to native protein?

To thoroughly evaluate recombinant versus native cytochrome b6:

ParameterMeasurement MethodExpected ValuesSignificance
Redox potentialPotentiometric titration-150 to -100 mV (low potential heme) 0 to +50 mV (high potential heme)Determines electron flow directionality
Plastoquinol oxidation rateStopped-flow spectroscopy50-200 s⁻¹Rate-limiting step in electron transport
Thermal stabilityDifferential scanning calorimetryTm = 55-65°CIndicates proper folding and stability
Substrate binding affinityIsothermal titration calorimetryKd = 1-10 μMInfluences flux control strength

Methodological approach:

  • Purify both native (from Glycine max thylakoids) and recombinant proteins

  • Conduct side-by-side kinetic measurements under identical conditions

  • Reconstitute proteins into liposomes for functional assays

  • Evaluate effects of pH and temperature on activity parameters

It's important to note that at lumen pH values between 7.5 and 6.5, plastoquinol re-oxidation by the cytochrome b6f complex represents the rate-limiting step of linear electron flux . Therefore, accurately determining these kinetic parameters is essential for understanding photosynthetic control mechanisms.

How can recombinant Glycine max cytochrome b6 be used to investigate photosynthetic control mechanisms?

Recombinant cytochrome b6 provides a powerful tool for investigating photosynthetic control mechanisms through the following methodological approaches:

  • Site-directed mutagenesis studies:

    • Modify specific amino acids involved in pH-dependent regulation

    • Alter quinol binding site residues to modulate electron transport rates

    • Investigate the specific amino acid protonation events that contribute to plastoquinol re-oxidation inhibition at low lumen pH

  • Reconstitution experiments:

    • Create proteoliposomes with defined lipid compositions

    • Systematically vary the stoichiometry of cytochrome b6f to other complexes

    • Measure electron transport rates and proton translocation efficiency

  • Structural biology applications:

    • Use purified recombinant protein for crystallization trials

    • Conduct cryo-EM studies of the assembled complex

    • Perform FRET-based interaction studies with other components

These approaches can help elucidate how the cytochrome b6f complex functions as a flux control point and how it coordinates with ATP synthase to balance the photosynthetic proton circuit .

What genomic modifications can enhance expression of functional recombinant cytochrome b6 in heterologous systems?

To optimize heterologous expression of Glycine max cytochrome b6:

  • Codon optimization:

    • Analyze codon usage bias in target expression system

    • Redesign the coding sequence while preserving critical regulatory motifs

    • Balance GC content for optimal mRNA stability

  • Expression enhancing elements:

    • Include appropriate N-terminal transit peptides for chloroplast targeting (if expressing in plants)

    • Add affinity tags that minimally impact protein folding (C-terminal usually preferred)

    • Incorporate ribosome binding site optimization for bacterial expression

  • Post-transcriptional modifications:

    • Address RNA secondary structures that might impede translation

    • Consider inclusion of introns for enhanced expression in eukaryotic systems

    • Optimize 5' and 3' UTRs for mRNA stability

  • Co-expression strategies:

    • Express heme biosynthesis genes to increase cofactor availability

    • Co-express chaperones that facilitate membrane protein folding

    • Consider co-expression of interaction partners (e.g., subunit IV)

This approach parallels methods used for other complex plant proteins where heterologous expression systems like E. coli have been successfully employed for functional validation .

What protocols are most effective for purifying recombinant Glycine max cytochrome b6?

A comprehensive purification protocol for recombinant cytochrome b6:

  • Cell lysis and membrane isolation:

    • Resuspend bacterial cells in buffer containing 50 mM Tris-HCl (pH 8.0), 100 mM NaCl

    • Disrupt cells using sonication or high-pressure homogenization

    • Separate membranes by ultracentrifugation (100,000×g, 1 hour)

  • Detergent solubilization:

    • Resuspend membranes in solubilization buffer with 1% n-dodecyl-β-D-maltoside (DDM)

    • Incubate with gentle agitation for 1 hour at 4°C

    • Remove insoluble material by ultracentrifugation

  • Affinity chromatography (assuming His-tagged protein):

    • Apply solubilized material to Ni-NTA column

    • Wash with buffer containing 20 mM imidazole and 0.05% DDM

    • Elute with buffer containing 250 mM imidazole and 0.05% DDM

  • Size exclusion chromatography:

    • Apply concentrated eluate to Superdex 200 column

    • Elute with buffer containing 25 mM HEPES (pH 7.5), 100 mM NaCl, 0.03% DDM

  • Verification methods:

    • SDS-PAGE and Western blotting

    • Absorption spectroscopy (characteristic peaks at ~563 nm and ~534 nm)

    • Heme content determination via pyridine hemochromogen assay

This purification approach can be modified based on the specific expression system used, following similar principles to those applied for other recombinant proteins described in search result .

How can researchers accurately quantify cytochrome b6 content in Glycine max tissues?

Accurate quantification of cytochrome b6 in plant tissues requires multiple complementary approaches:

MethodPrincipleSensitivityAdvantagesLimitations
Absorption spectroscopyDifferential spectra of reduced vs. oxidized cytochromes~0.5 nmol/mLFast, non-destructiveInterference from other cytochromes
ImmunoblottingAntibody detection of PetB protein~0.1 ng/bandSpecific for the proteinSemi-quantitative without standards
Mass spectrometryTargeted proteomics with labeled peptide standards~1-10 fmolHighly specific and quantitativeEquipment-intensive
Functional assaysMeasurement of electron transport ratesN/AQuantifies active proteinAffected by other rate-limiting steps

Procedural recommendations:

  • Prepare samples using optimized buffer conditions to prevent degradation

  • Include controls for extraction efficiency across different tissue types

  • Normalize data to chlorophyll content or total membrane protein

  • Consider developmental stage and growth conditions as they significantly influence complex stoichiometry

What experimental design best elucidates the interaction between recombinant cytochrome b6 and other components of the photosynthetic electron transport chain?

To effectively study interactions between recombinant cytochrome b6 and other photosynthetic components:

  • In vitro reconstitution studies:

    • Purify individual components of the electron transport chain

    • Reconstitute them into liposomes in controlled ratios

    • Measure electron transfer rates using artificial electron donors/acceptors

    • Evaluate the effects of altered stoichiometry on electron transport efficiency

  • Surface plasmon resonance (SPR):

    • Immobilize purified recombinant cytochrome b6 on a sensor chip

    • Flow solutions containing potential interaction partners

    • Measure binding kinetics and affinity constants

    • Test how conditions like pH and ionic strength affect interactions

  • Co-immunoprecipitation approaches:

    • Express tagged versions of cytochrome b6 in plant systems

    • Perform pull-down assays under mild solubilization conditions

    • Identify interaction partners using mass spectrometry

    • Verify with reciprocal pull-downs

  • FRET-based interaction studies:

    • Create fusion proteins with appropriate fluorophores

    • Express in appropriate systems (isolated chloroplasts or proteoliposomes)

    • Measure energy transfer as indication of protein proximity

    • Use acceptor photobleaching to confirm specific interactions

These approaches can help elucidate how cytochrome b6f complex interactions contribute to the co-limitation of photosynthesis by cytochrome b6f complex and ATP synthase as described in search result .

How can researchers overcome expression and folding issues with recombinant Glycine max cytochrome b6?

When facing challenges with expression and proper folding:

  • Expression optimization:

    • Lower induction temperature (16-20°C) to slow protein production and improve folding

    • Reduce inducer concentration to prevent overwhelming cellular machinery

    • Consider specialized E. coli strains (C41/C43) designed for membrane protein expression

    • Test multiple fusion tags and their positions (N- vs. C-terminal)

  • Folding enhancement:

    • Co-express molecular chaperones (GroEL/GroES, DnaK/DnaJ)

    • Add heme precursors (δ-aminolevulinic acid) to culture medium

    • Include chemical chaperones in growth media (glycerol, trehalose)

    • Optimize membrane mimetics for protein extraction (detergent screening)

  • Troubleshooting analysis:

    • Track expression levels at different time points post-induction

    • Analyze membrane fraction vs. inclusion bodies to determine protein localization

    • Use fluorescent fusion tags to monitor cellular localization in real-time

    • Employ in-gel heme staining to confirm cofactor incorporation

Similar approaches have been successfully used for other complex plant proteins as demonstrated in the heterologous expression of plant UDP-dependent glycosyltransferases described in search result .

What strategies can resolve data inconsistencies when comparing native and recombinant cytochrome b6 activities?

When facing data inconsistencies:

  • Systematic parameter evaluation:

    • Test activity across a range of pH values (5.5-8.0)

    • Vary temperature conditions (10-40°C)

    • Examine multiple buffer compositions and ionic strengths

    • Assess the impact of different detergents or membrane mimetics

  • Protein quality assessment:

    • Confirm heme content using pyridine hemochromogen assay

    • Verify protein:lipid ratios in reconstituted systems

    • Analyze oligomeric state using BN-PAGE or analytical ultracentrifugation

    • Check for post-translational modifications using mass spectrometry

  • Control experiments:

    • Perform side-by-side assays of native and recombinant proteins

    • Include internal standards for normalization

    • Validate your assays with proteins of known activity

    • Use multiple independent protein preparations

  • Data normalization approaches:

    • Calculate activity per mole of bound heme rather than total protein

    • Account for differences in reconstitution efficiency

    • Consider the orientation of proteins in reconstituted systems

    • Evaluate the impact of reactive oxygen species on activity measurements

These methodical approaches can help identify sources of variability and ensure accurate comparisons between native and recombinant protein activities.

What are the future research directions for recombinant Glycine max cytochrome b6 studies?

Emerging research opportunities include:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.