Recombinant Glycine max Cytochrome c oxidase subunit 2 (COX2)

Shipped with Ice Packs
In Stock

Description

Production of Recombinant COX2

While no direct studies on recombinant Glycine max COX2 were identified, methodologies for recombinant COX2 production in other species involve:

StepDescription
Gene CloningIsolation of the COX2 gene from Glycine max mitochondrial DNA .
Vector DesignSubcloning into expression vectors (e.g., pET, pGEX) with affinity tags .
Host ExpressionExpression in E. coli or yeast systems, optimized for mitochondrial targeting .
Protein PurificationAffinity chromatography (e.g., His-tag purification) .
Activity AssayMeasurement of cytochrome c oxidation rates or oxygen consumption .

Anti-Inflammatory Potential

Hydrolyzed Glycine max extracts have demonstrated COX-2 (cyclooxygenase-2) inhibitory effects in murine colitis models, reducing inflammation markers like prostaglandin E2 (PGE2) . While this refers to cyclooxygenase-2 (COX-2), not cytochrome c oxidase subunit 2, it highlights the broader biomedical relevance of Glycine max-derived compounds.

Mitochondrial Dysregulation Studies

Mutations in COX2 homologs (e.g., yeast and human MT-CO2) impair electron transport, leading to:

  • Reduced ATP synthesis .

  • Mitochondrial disorders such as Leigh syndrome and complex IV deficiency .
    These findings underscore the functional conservation of COX2 across species and its potential as a target for metabolic engineering in plants.

Challenges and Future Directions

  • Expression Hurdles: Mitochondrial targeting and proper folding of recombinant COX2 require chaperones like Oxa1p and assembly factors .

  • Functional Validation: Assays must confirm CuA center integrity and proton translocation efficiency .

  • Agricultural Applications: Enhancing COX2 activity could improve stress tolerance in crops, though this remains unexplored in Glycine max.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
COX2; COII; COXII; GlmaxMp76; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-260
Protein Length
full length protein
Species
Glycine max (Soybean) (Glycine hispida)
Target Names
COX2
Target Protein Sequence
MKFEWLFLTIAPCDAAEPWQLGFQDAATPMMQGIIDLHHDIFFFLILILVFVSRILVRAL WHFHYKKNPIPQRIVHGTTIEILRTIFPSIIPMFIAIPSFALLYSMDEVVVDPAITIKAI GHQWYRTYEYSDYNSSDEQSLTFDSYTIPEDDLELGQSRLLEVDNRVVVPAKTHLRIIVT PADVPHSWAVPSLGVKCDAVPGRLNQISISVQREGVYYGQCSEICGTNHAFTPIVVEAVP SKDYGSRVFNQLIPQTTGEA
Uniprot No.

Target Background

Function
Glycine max Cytochrome c oxidase subunit 2 (COX2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred through the dinuclear copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site in subunit 1 – a binuclear center (BNC) consisting of heme A3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.
Database Links

KEGG: gmx:15308623

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Glycine max Cytochrome c oxidase subunit 2 (COX2) and what are its primary functions?

Glycine max (soybean) Cytochrome c oxidase subunit 2 (COX2) is a mitochondrially-encoded protein that serves as a critical component of the cytochrome c oxidase complex (Complex IV) in the electron transport chain. This protein contains binding sites for both the CuA redox center and cytochrome c, making it essential for electron transfer during cellular respiration. Similar to other eukaryotic COX2 proteins, the soybean variant contains highly conserved glycine residues that are crucial for proper protein folding and interaction with cytochrome c during electron transport . The full-length protein consists of 260 amino acids and functions within the inner mitochondrial membrane to facilitate oxygen reduction to water as the terminal step of the respiratory electron transport chain. Mutations in this gene can significantly disrupt respiratory function, as demonstrated in yeast models with analogous COX2 genes .

How does recombinant Glycine max COX2 differ from native COX2 protein?

Recombinant Glycine max COX2 protein is typically produced with modifications such as His-tagging to facilitate purification and experimental manipulation, as seen in commercially available preparations . While the core protein sequence remains identical to the native form, these modifications can affect protein folding, stability, and activity. The recombinant protein is typically produced in heterologous expression systems (bacterial, insect, or mammalian cells) rather than being extracted directly from soybean mitochondria. This production method allows for controlled expression of specific protein variants but may result in differences in post-translational modifications compared to the native protein. Researchers should consider these potential differences when designing experiments, particularly when studying protein-protein interactions or enzymatic activity that might be influenced by tertiary structure or post-translational modifications.

What experimental models are most appropriate for studying Glycine max COX2 function?

When studying Glycine max COX2 function, researchers can employ several experimental models depending on their specific research questions. For molecular interaction studies, purified recombinant protein systems allow for controlled examination of binding partners and electron transfer kinetics. Cell-based systems using either plant cells or heterologous expression in yeast can provide insights into protein localization and function in a cellular context. Yeast models are particularly valuable because COX2 function is highly conserved, and yeast strains with mutations in their own COX2 gene exhibit clear respiratory deficiency phenotypes . These respiratory-deficient strains can be complemented with wild-type or mutant forms of Glycine max COX2 to assess functional conservation and the effects of specific mutations. For whole-organism studies, transgenic Arabidopsis plants serve as a compatible model system for examining the physiological roles of soybean mitochondrial proteins within a plant context.

How can site-directed mutagenesis of conserved glycine residues in recombinant Glycine max COX2 inform our understanding of protein function?

Site-directed mutagenesis of conserved glycine residues in recombinant Glycine max COX2 offers profound insights into protein structure-function relationships. Research with analogous mutations in yeast has demonstrated that converting conserved glycine to arginine can render the cytochrome c oxidase complex non-functional, resulting in respiratory deficiency . This suggests that conserved glycine residues in COX2 play critical roles in either CuA center ligation or cytochrome c interaction. Systematic mutagenesis studies should target glycine residues within the regions implicated in these functions, particularly those showing evolutionary conservation across species.

When designing such experiments, researchers should:

  • Begin with in silico structural predictions to identify glycine residues most likely to impact function

  • Generate a series of mutants with substitutions of varying chemical properties (size, charge, hydrophobicity)

  • Assess protein expression, stability, incorporation into the cytochrome c oxidase complex, and respiratory function

  • Perform complementation studies in COX2-deficient yeast strains to determine if mutant proteins restore function

The recovery of respiratory function through second-site suppressors or revertants, as observed in yeast models, can identify critical interaction networks within the protein and with other components of the respiratory chain . These experiments provide mechanistic understanding beyond simple sequence conservation analysis.

What are the methodological considerations for assessing electron transfer efficiency of recombinant Glycine max COX2 in vitro?

Assessing electron transfer efficiency of recombinant Glycine max COX2 requires careful experimental design and specialized techniques. The protein must be properly incorporated into a functional cytochrome c oxidase complex, either through reconstitution with other purified subunits or expression in a suitable membrane system. For in vitro analysis, researchers should consider:

  • Membrane Reconstitution: Incorporate the purified His-tagged recombinant COX2 protein into liposomes or nanodiscs with appropriate lipid composition to mimic the mitochondrial inner membrane environment.

  • Redox Partner Preparation: Prepare reduced cytochrome c as the electron donor and an appropriate terminal electron acceptor system.

  • Spectrophotometric Assays: Monitor cytochrome c oxidation by tracking absorbance changes at 550 nm over time. Calculate electron transfer rates under varying substrate concentrations to determine kinetic parameters.

  • Oxygen Consumption Assays: Measure oxygen consumption using polarographic methods with oxygen-sensitive electrodes to directly quantify the terminal reaction catalyzed by the complex.

  • Proton Pumping Efficiency: Assess coupling between electron transfer and proton translocation using pH-sensitive probes in reconstituted vesicle systems.

A comparative analysis with wild-type protein and specific mutants can identify critical residues affecting electron transfer efficiency. Temperature dependence studies can provide additional insights into the thermodynamics of the electron transfer process.

How can researchers effectively characterize the interaction between recombinant Glycine max COX2 and cytochrome c?

Characterizing the interaction between recombinant Glycine max COX2 and cytochrome c requires a multi-faceted approach combining biophysical, biochemical, and computational methods. Given the critical role of COX2 in binding cytochrome c and facilitating electron transfer, detailed interaction studies provide valuable mechanistic insights.

Effective characterization methods include:

  • Surface Plasmon Resonance (SPR): Immobilize His-tagged recombinant COX2 on a sensor chip and measure real-time binding kinetics with cytochrome c, determining association and dissociation rate constants.

  • Isothermal Titration Calorimetry (ITC): Quantify thermodynamic parameters of binding, including enthalpy, entropy, and stoichiometry.

  • Cross-linking Mass Spectrometry: Identify specific amino acid residues at the interaction interface using chemical cross-linkers followed by proteolytic digestion and mass spectrometric analysis.

  • Mutagenesis Studies: Systematically alter conserved residues in the proposed binding interface (particularly conserved glycine residues) and assess impact on binding affinity and electron transfer rates.

  • Computational Molecular Docking: Generate in silico models of the COX2-cytochrome c complex to predict key interaction points for experimental validation.

Comparative studies using cytochrome c from different species can provide evolutionary insights into the specificity of this interaction. Studies in yeast models have demonstrated that mutations in conserved glycine residues of COX2 can disrupt functional interactions with cytochrome c, emphasizing the importance of these residues in maintaining proper binding interfaces .

What expression systems are optimal for producing functional recombinant Glycine max COX2 protein?

The optimal expression system for producing functional recombinant Glycine max COX2 protein depends on experimental requirements for protein yield, post-translational modifications, and maintenance of native structure. As a mitochondrially-encoded membrane protein, COX2 presents several production challenges that should be addressed through system selection.

Recommended expression systems and considerations:

  • Bacterial Expression Systems (E. coli):

    • Advantages: High yield, cost-effective, rapid production

    • Limitations: Lack of post-translational modifications, potential for inclusion body formation

    • Optimization: Use specialized strains (e.g., C41/C43) designed for membrane protein expression; incorporate fusion partners (e.g., MBP, SUMO) to improve solubility

  • Yeast Expression Systems (S. cerevisiae, P. pastoris):

    • Advantages: Eukaryotic folding machinery, moderate post-translational modifications, suitable for membrane proteins

    • Considerations: Can integrate the recombinant protein into mitochondria when using appropriate targeting sequences

    • Particularly valuable given the natural ability of yeast to express and assemble functional cytochrome c oxidase complexes

  • Insect Cell Expression:

    • Advantages: Advanced eukaryotic folding machinery, superior for complex membrane proteins

    • Disadvantages: Higher cost, longer production time

    • Most suitable for structural studies requiring highly-folded functional protein

  • Plant-Based Expression Systems:

    • Advantages: Native cellular environment for Glycine max proteins, appropriate post-translational modifications

    • Considerations: Can direct protein to mitochondria using native targeting sequences

The commercially available His-tagged recombinant full-length Glycine max COX2 protein provides a standardized starting point, but researchers with specific requirements may need to develop customized expression strategies optimized for their particular experimental applications.

What purification strategies maximize the yield and activity of recombinant Glycine max COX2?

Purifying recombinant Glycine max COX2 while maintaining structural integrity and functional activity requires specialized approaches for membrane proteins. The use of His-tagged constructs, as seen in commercial preparations , facilitates initial purification but must be complemented with additional steps to ensure high purity and activity.

Recommended purification workflow:

  • Membrane Fraction Isolation:

    • Lyse cells using gentle methods (sonication or French press)

    • Separate membrane fraction through ultracentrifugation

    • Solubilize membranes using appropriate detergents (n-dodecyl β-D-maltoside or digitonin) that maintain protein-protein interactions within the cytochrome c oxidase complex

  • Affinity Chromatography:

    • Utilize His-tag for immobilized metal affinity chromatography (IMAC)

    • Optimize imidazole concentration in washing and elution buffers to minimize non-specific binding while maximizing target protein recovery

    • Consider on-column detergent exchange during washing steps

  • Size Exclusion Chromatography:

    • Separate monomeric protein from aggregates and contaminants

    • Assess oligomeric state and complex formation

    • Confirm proper complex assembly through co-elution with other cytochrome c oxidase subunits

  • Activity Preservation Strategies:

    • Maintain a stable detergent concentration above critical micelle concentration throughout purification

    • Include glycerol (10-20%) to stabilize the protein

    • Consider lipid supplementation to maintain native-like environment

    • Use reducing agents to protect critical cysteine residues

  • Quality Control:

    • Assess purity by SDS-PAGE and Western blotting

    • Verify protein identity by mass spectrometry

    • Confirm functional activity through spectroscopic assays of cytochrome c oxidation

When working with recombinant COX2, researchers should evaluate whether to purify the isolated subunit or the entire cytochrome c oxidase complex, as the isolated subunit may have limited stability and activity outside its native complex environment.

How can researchers effectively reconstitute recombinant Glycine max COX2 into functional cytochrome c oxidase complexes?

Reconstituting recombinant Glycine max COX2 into functional cytochrome c oxidase complexes requires careful consideration of protein-protein interactions and membrane environment. The process must preserve the integrity of binding sites for both the CuA redox center and cytochrome c to maintain electron transfer capability.

Recommended reconstitution approaches:

  • Co-expression Strategy:

    • Simultaneously express recombinant Glycine max COX2 with other cytochrome c oxidase subunits

    • Use polycistronic vectors or multiple plasmids with compatible origins of replication

    • Direct proteins to appropriate cellular compartments using targeting sequences

  • In vitro Reconstitution:

    • Purify individual subunits including His-tagged COX2

    • Combine purified components in optimized buffer conditions with appropriate detergent

    • Gradually remove detergent using biobeads or dialysis while incorporating the complex into liposomes

    • Verify complex formation through analytical size exclusion chromatography and blue native PAGE

  • Hybrid Complex Formation:

    • Express recombinant Glycine max COX2 in a system that produces endogenous cytochrome c oxidase components

    • Allow incorporation of the recombinant protein into native complexes

    • Particularly effective in yeast expression systems where complementation of COX2-deficient strains can confirm functional incorporation

  • Functional Verification:

    • Assess electron transfer activity using cytochrome c oxidation assays

    • Measure oxygen consumption as an indicator of complete complex formation

    • Evaluate proton pumping efficiency in reconstituted proteoliposomes

Researchers should note that mutations in conserved glycine residues can disrupt COX2 function within the complex, as demonstrated in yeast studies . When introducing mutations for structure-function analysis, careful monitoring of complex assembly is essential to distinguish assembly defects from functional defects.

How should researchers interpret activity assays when comparing wild-type and mutated recombinant Glycine max COX2?

Interpreting activity assays when comparing wild-type and mutated recombinant Glycine max COX2 requires careful consideration of multiple parameters beyond simple endpoint measurements. Studies in yeast have demonstrated that mutations in conserved glycine residues can dramatically affect respiratory function , and similar effects might be expected in the soybean protein.

Key considerations for data interpretation:

  • Multiple Parameter Assessment:

    • Measure both initial rates and steady-state activities

    • Determine Km and Vmax values for cytochrome c oxidation

    • Calculate electron transfer efficiency (electrons transferred per oxygen consumed)

    • Assess proton pumping efficiency when possible

  • Distinguishing Assembly vs. Activity Effects:

    • Quantify complex assembly efficiency through BN-PAGE or co-immunoprecipitation

    • Normalize activity measurements to assembled complex concentration rather than total protein

    • Use spectroscopic techniques to verify proper incorporation of metal centers

  • Comparative Analysis Framework:

    ParameterWild-typeConserved Glycine MutationsOther Mutations
    Complex Assembly (%)90-100Variable (0-100)Variable (0-100)
    Cytochrome c Kd (μM)10-50Often increasedVariable
    Electron Transfer Rate (s⁻¹)200-600Often decreasedVariable
    Oxygen Consumption (nmol/min/mg)80-120Often decreasedVariable
    Proton Pumping Efficiency (H⁺/e⁻)1.0Often compromisedVariable
  • Compensatory Effects Analysis:

    • Look for second-site suppressor mutations that restore activity

    • Analyze revertants for insights into structure-function relationships

    • Studies in yeast models have shown that revertants can arise through various mechanisms, including restoration of the original glycine codon or compensatory changes in interacting proteins

  • Environmental Sensitivity Testing:

    • Compare activities across a range of pH values, temperatures, and ionic strengths

    • Mutant proteins often show differential sensitivity to environmental conditions

    • These differences can reveal mechanistic insights about the role of specific residues

When interpreting results, researchers should consider the possibility of partial activities and subtle effects that might be physiologically significant but challenging to detect in vitro. Integration of multiple assay types provides the most comprehensive understanding of mutation effects.

What are the most informative approaches for structural characterization of recombinant Glycine max COX2?

Structural characterization of recombinant Glycine max COX2 presents challenges due to its membrane protein nature but provides essential insights into function. A multi-technique approach yields the most comprehensive structural information.

Recommended structural characterization methods:

Studies of COX2 mutants in yeast have demonstrated that single amino acid changes, particularly in conserved glycine residues, can dramatically affect protein function . Structural characterization of equivalent mutations in Glycine max COX2 can provide mechanistic explanations for these functional effects and guide rational design of variants with altered properties.

How can researchers effectively analyze the impact of Glycine max COX2 mutations on mitochondrial function?

Analyzing the impact of Glycine max COX2 mutations on mitochondrial function requires a comprehensive approach that integrates molecular, cellular, and physiological measurements. Studies in yeast have demonstrated that mutations in conserved residues of COX2 can profoundly affect respiratory capacity , and similar analytical approaches can be applied to plant mitochondrial systems.

Recommended analytical framework:

  • Respiratory Chain Function Analysis:

    • Measure oxygen consumption rates in isolated mitochondria

    • Determine respiratory control ratios to assess coupling efficiency

    • Use specific substrates and inhibitors to isolate Complex IV activity

    • Analyze membrane potential using potentiometric dyes

  • Complementation Studies in Model Systems:

    • Express Glycine max COX2 variants in respiratory-deficient yeast strains

    • Assess restoration of growth on non-fermentable carbon sources

    • Quantify rescue of mitochondrial function using respiration measurements

    • This approach has proven effective in analyzing yeast COX2 mutations and revertants

  • In vivo Functional Analysis in Plant Systems:

    • Use RNA interference or CRISPR techniques to reduce endogenous COX2

    • Complement with recombinant wild-type or mutant variants

    • Assess impacts on plant growth, development, and stress responses

    • Measure photosynthetic parameters as indirect indicators of mitochondrial function

  • Comparative Analysis Framework:

    ParameterWild-typeSingle MutationMultiple Mutations
    Complex IV Activity (nmol O₂/min/mg)150-200Variable (0-200)Often severely reduced
    Respiratory Control Ratio3.0-5.0Often decreasedOften uncoupled
    ATP Production (nmol/min/mg)400-600VariableOften severely reduced
    ROS Production (% of WT)100Often increasedOften dramatically increased
    Mitochondrial Membrane Potential (mV)-180 to -220Often reducedOften collapsed
  • Multi-Omics Integration:

    • Transcriptomics: Assess compensatory gene expression changes

    • Proteomics: Quantify effects on respiratory complex assembly

    • Metabolomics: Measure downstream impacts on TCA cycle and other pathways

    • Network analysis to identify critical nodes and pathways affected by COX2 dysfunction

This analytical framework allows researchers to distinguish between primary effects of mutations (direct impact on electron transfer) and secondary consequences (altered mitochondrial biogenesis, compensatory pathways, oxidative stress responses). The identification of revertants or suppressor mutations, as observed in yeast studies , can provide valuable insights into the molecular networks that support cytochrome c oxidase function.

How can recombinant Glycine max COX2 be used to study plant-specific aspects of mitochondrial respiration?

Recombinant Glycine max COX2 offers unique opportunities to investigate plant-specific aspects of mitochondrial respiration that differ from animal and fungal systems. While the core function of cytochrome c oxidase is conserved across eukaryotes, plants have evolved distinct regulatory mechanisms to coordinate mitochondrial activity with photosynthesis and respond to environmental stresses.

Research applications for plant-specific investigations:

  • Alternative Oxidase (AOX) Pathway Interactions:

    • Study competition between cytochrome c oxidase and AOX for electrons

    • Investigate how COX2 variants affect electron partitioning between pathways

    • Analyze the role of cytochrome c-COX2 binding affinity in pathway regulation

    • Create an experimental system using purified recombinant COX2 to reconstitute these interactions in vitro

  • Stress Response Regulation:

    • Examine post-translational modifications of COX2 under stress conditions

    • Analyze how mutations in conserved residues affect stress responsiveness

    • Compare stress-induced changes in COX2 function between Glycine max and other species

  • Photosynthesis-Respiration Coordination:

    • Investigate how cytochrome c oxidase activity adjusts to changing photosynthetic rates

    • Study the impact of light/dark transitions on COX2 function and modification

    • Develop in vitro systems that mimic the dynamic cellular environment of plant cells

  • Tissue-Specific Respiration Regulation:

    • Compare COX2 variants from different soybean tissues

    • Study tissue-specific interacting partners that modulate COX2 function

    • Analyze developmental changes in cytochrome c oxidase composition and activity

  • Evolutionary Adaptations in Plant COX2:

    • Compare conserved domains between Glycine max COX2 and other species

    • Identify plant-specific sequence elements through comparative analysis

    • Use site-directed mutagenesis to test the functional significance of plant-specific residues

    • Consider the conservation of glycine residues that have been shown to be critical in other systems

These research directions benefit from the availability of recombinant full-length Glycine max COX2 protein , which provides a platform for controlled experimental manipulations that would be difficult to achieve in whole organelle or cellular systems.

What are the considerations for using recombinant Glycine max COX2 in studies of oxidative stress and mitochondrial dysfunction?

Using recombinant Glycine max COX2 in studies of oxidative stress and mitochondrial dysfunction requires careful experimental design to ensure physiological relevance while leveraging the advantages of a controlled recombinant system. Cytochrome c oxidase plays a dual role in oxidative stress – it can both prevent ROS formation through efficient electron transfer and potentially generate ROS when functioning sub-optimally.

Key experimental considerations:

  • Oxidative Modification Analysis:

    • Identify specific residues susceptible to oxidative modifications

    • Compare modification patterns between recombinant protein and native protein

    • Analyze how mutations in conserved glycine residues affect susceptibility to oxidation

    • Correlate modifications with functional changes in electron transfer efficiency

  • ROS Production Measurement:

    • Develop assay systems to measure ROS generation by reconstituted cytochrome c oxidase

    • Compare ROS production between wild-type and mutant variants under various conditions

    • Assess how structural alterations in COX2 affect electron leakage and ROS generation

    • Consider the impact of conserved glycine residues that may be important for maintaining proper electron transfer pathways

  • Mitochondrial Dysfunction Models:

    • Reconstitute systems with defined COX2 variants to model specific dysfunctional states

    • Use complementation in respiratory-deficient systems to assess functional rescue

    • Compare the impact of equivalent mutations across species to identify conserved mechanisms

    • This approach has been productive in yeast systems with COX2 mutations

  • Interaction with Antioxidant Systems:

    • Study how antioxidant molecules affect COX2 function and stability

    • Investigate potential protective mechanisms against oxidative damage

    • Examine interactions between COX2 and plant-specific antioxidant systems

  • Experimental Design Matrix:

    ConditionWild-type COX2Glycine Mutant COX2Oxidized COX2
    Normal O₂Baseline functionOften impairedModerately impaired
    HypoxiaAdaptive responseVariable responsePoor adaptation
    Oxidative StressProtective capacityReduced protectionFurther dysfunction
    High Energy DemandUpregulated functionLimited capacityEnergy crisis

When designing these studies, researchers should consider that even single amino acid changes, particularly in conserved glycine residues, can dramatically affect both the assembly and function of cytochrome c oxidase complexes, as demonstrated in yeast models . The availability of recombinant Glycine max COX2 protein enables systematic structure-function studies that would be challenging using only native protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.