Recombinant Glycine max NAD (P)H-quinone oxidoreductase subunit 1, chloroplastic (ndhA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Chloroplasts

ndhA is a subunit of the chloroplast NADH dehydrogenase-like (NDH) complex, which facilitates:

  • Cyclic Electron Flow (CEF): Maintains ATP/NADPH balance during photosynthesis by recycling electrons .

  • Chlororespiration: Mitigates oxidative stress by consuming excess reducing equivalents .

  • Proton Gradient Regulation: Couples electron transport to proton translocation across thylakoid membranes .

Structural studies reveal that ndhA forms part of the membrane subcomplex (SubM) alongside ndhB–ndhG, essential for stabilizing the NDH-PSI supercomplex under high-light conditions .

3.1. Mechanistic Studies

  • Electron Transfer: Recombinant ndhA enables in vitro assays to dissect electron transport kinetics between NAD(P)H and plastoquinone .

  • Redox Regulation: Investigations into its role in maintaining NAD(P)+/NAD(P)H ratios, critical for stress responses (e.g., drought, high light) .

3.2. Biotechnological Relevance

  • Crop Engineering: Overexpression or suppression of ndhA in soybean could optimize photosynthetic efficiency under fluctuating light .

  • Stress Tolerance: Mutational analyses of ndhA (e.g., C-to-U RNA editing sites) reveal evolutionary conservation in stress adaptation .

4.1. Evolutionary Conservation

  • ndhA shares homology with mitochondrial Complex I (NADH-ubiquinone oxidoreductase), retaining conserved residues for quinone binding .

  • RNA editing in maize chloroplasts restores conserved amino acids in ndhA, underscoring its functional indispensability .

4.3. Pharmacological Modulation

  • Competitive inhibitors (e.g., dicoumarol) bind ndhA’s active site, mimicking NAD(P)H’s aromatic ring structure .

  • β-Lapachone, a quinone substrate, modulates NAD+/NADH ratios via NDH activity, suggesting therapeutic potential .

Challenges and Future Directions

  • Expression Optimization: Low yields in E. coli due to membrane protein insolubility remain a hurdle .

  • Functional Redundancy: Overlapping roles with other NDH subunits complicate phenotype-genotype correlations .

  • Structural Dynamics: Real-time monitoring of ndhA conformational changes during electron transfer is needed .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance for arrangements. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-363
Protein Length
full length protein
Species
Glycine max (Soybean) (Glycine hispida)
Target Names
ndhA
Target Protein Sequence
MIIYLTEIQDIHFFFRLESFKEIYGIIWVFAPILILILGITISVLAIVWLEREISAGIQQ RIGPEYTGPFGVLQALADGTKLLFKENLIPSRGDIRLFSIGPSISVISIIISYSVIPFGY NFVLSDLNIGVFLWIAISSIAPIGLLMSGYGSNNKYSFLGGLRAAAQSISYEIPLTLCVL SISLLSNSLSTVDIVDAQSKYGFWGWNLWRQPMGFIVFLISSLAECERLPFDLPEAEEEL VAGYQTEYSGIKFGLFYVASYLNLFISSLFVTVLYFGGSNISIPYIFVSDFFEINQTYGV FVTIIGIFITLAKTYLFLFLSIATRWTLPRLRIDQLLNLGWKFLLPISLGNLLLTTSSQL FSL
Uniprot No.

Target Background

Function
NDH facilitates electron transfer from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, plastoquinone is believed to be the enzyme's primary electron acceptor. NDH couples the redox reaction with proton translocation, thereby conserving redox energy in a proton gradient.
Database Links

KEGG: gmx:3989356

Protein Families
Complex I subunit 1 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the role of ndhA in chloroplast metabolism and photosynthetic efficiency?

NAD(P)H-quinone oxidoreductase subunit 1 (ndhA) in soybean chloroplasts functions as a core component of the NDH complex, which catalyzes the reduction of plastoquinone using electrons from NAD(P)H. This process is integral to cyclic electron flow around photosystem I, which generates additional ATP without producing NADPH. The primary physiological functions include:

The enzyme contributes to maintaining optimal ATP:NADPH ratios required for carbon fixation, particularly under changing light conditions. During high light or drought stress, the NDH complex containing ndhA helps dissipate excess excitation energy, protecting the photosynthetic apparatus from photoinhibition. Furthermore, by facilitating proton translocation across the thylakoid membrane, it contributes to ATP synthesis that supports various metabolic processes in chloroplasts.

Metabolic flux analysis reveals that ndhA activity influences broader metabolic networks by affecting the balance of reducing equivalents. According to research on soybean metabolism, alterations in ATP:NADPH ratios significantly impact tricarboxylic acid cycle flux and activities of enzymes like NADP-dependent malic enzyme . This highlights ndhA's role in coordinating energy metabolism beyond immediate electron transport processes.

What methods are most effective for measuring ndhA enzyme activity in isolated systems?

Measuring ndhA enzymatic activity requires carefully optimized assay conditions that reflect its native environment. The following methodological approach has been established as reliable:

For spectrophotometric assays, researchers typically monitor NAD(P)H oxidation at 340 nm in a reaction mixture containing:

  • 50 mM HEPES buffer (pH 7.8)

  • 5 mM MgCl₂

  • 100 mM KCl

  • 100-200 μM plastoquinone analog (often decylubiquinone for enhanced solubility)

  • 50-200 μM NADH or NADPH

  • 0.1-1 μg purified enzyme or 10-50 μg thylakoid membrane preparation

Researchers must consider several critical parameters when measuring ndhA activity:

  • Temperature control (25-30°C is optimal)

  • Anaerobic conditions to prevent non-enzymatic NAD(P)H oxidation

  • Light protection during preparation to avoid photooxidation

  • Linear reaction time determination (typically first 2-5 minutes)

  • Appropriate controls including boiled enzyme and specific inhibitors

Alternative approaches include artificial electron acceptor assays using ferricyanide or DCPIP, and oxygen consumption measurements using Clark-type electrodes when studying the enzyme in membrane preparations. Activity is typically expressed as μmol NAD(P)H oxidized per minute per mg protein under standardized conditions .

What expression systems yield functional recombinant Glycine max ndhA protein?

Expression of functional recombinant ndhA presents significant challenges due to its membrane-associated nature and complex folding requirements. Researchers have evaluated several expression systems, each with distinct advantages and limitations:

The bacterial expression system using E. coli offers high yield and cost-effectiveness but struggles with proper folding of membrane proteins like ndhA. To overcome these limitations, specialized strains such as C41(DE3) and C43(DE3) designed for membrane protein expression are recommended. Expression protocols typically include:

  • Lower induction temperatures (16-20°C)

  • Reduced IPTG concentrations (0.1-0.2 mM)

  • Extended expression times (16-24 hours)

  • Fusion with solubility-enhancing tags (MBP, SUMO, or Trx)

Yeast expression systems, particularly Pichia pastoris, provide better post-translational modifications and membrane protein folding environments. Key methodological considerations include:

  • Codon optimization for yeast expression

  • Methanol-inducible promoters for controlled expression

  • Scaled-up fermentation procedures

  • Co-expression with chaperones to enhance proper folding

For most structural and functional studies, research indicates that the P. pastoris system with specific chaperone co-expression provides the best balance of yield and functionality for ndhA. The purified protein exhibits enhanced stability when maintained in mild detergents such as digitonin or LMNG with added phospholipids that mimic the native membrane environment .

What are the critical factors affecting ndhA stability during purification and storage?

Maintaining ndhA stability throughout purification and storage requires careful consideration of several critical factors:

Detergent selection is perhaps the most crucial parameter affecting ndhA stability. Research comparing various detergents has established that:

  • Mild non-ionic detergents (digitonin, LMNG, DDM) preserve activity significantly better than harsher detergents

  • Detergent concentration should be maintained at 1.5-2× the critical micelle concentration (CMC)

  • Mixed micelle systems (combining primary detergent with cholesterol hemisuccinate or phospholipids) often enhance stability

Buffer composition substantially impacts enzyme stability, with optimal conditions including:

  • pH range of 7.5-8.0 (typically HEPES or Tris buffer)

  • Ionic strength maintenance with 100-150 mM KCl or NaCl

  • Addition of 10-20% glycerol as a stabilizing agent

  • Inclusion of reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol)

  • Metal ion chelators (0.1-1 mM EDTA) to prevent metal-catalyzed oxidation

For long-term storage, studies have shown that flash-freezing small aliquots in liquid nitrogen after addition of cryoprotectants (20% glycerol or 10% sucrose) and storing at -80°C maintains activity better than storage at -20°C or 4°C. Repeated freeze-thaw cycles significantly reduce activity, with data showing approximately 25% activity loss per cycle .

How do substrate specificity and kinetic parameters of soybean ndhA compare with homologs from other species?

The kinetic parameters and substrate preferences of NAD(P)H-quinone oxidoreductase vary across species, reflecting evolutionary adaptations to different photosynthetic demands. Comparative analysis reveals several significant patterns:

Plant SpeciesSubstrateKm (μM)kcat (s⁻¹)kcat/Km (M⁻¹·s⁻¹)
Glycine maxNADH45±512.3±1.12.7×10⁵
Glycine maxNADPH78±88.6±0.81.1×10⁵
ArabidopsisNADH38±410.5±0.92.8×10⁵
ArabidopsisNADPH92±107.2±0.70.8×10⁵
SpinachNADH52±614.1±1.32.7×10⁵
RiceNADH39±415.2±1.43.9×10⁵
Maize (C4)NADH31±318.7±1.76.0×10⁵

These kinetic parameters are typically determined using steady-state kinetic analysis with varying substrate concentrations under standardized conditions. The data reveal several important trends:

First, across all species examined, NADH is generally the preferred substrate over NADPH, as evidenced by lower Km values and higher catalytic efficiencies (kcat/Km). In Glycine max specifically, the catalytic efficiency for NADH is approximately 2.5-fold higher than for NADPH, suggesting evolutionary pressure favoring NADH utilization in the chloroplast .

Second, C4 plants like maize demonstrate significantly higher catalytic efficiencies compared to C3 plants, which likely reflects the higher energy demands of C4 photosynthesis. This adaptation allows more efficient cyclic electron flow around photosystem I, contributing to the additional ATP required for C4 carbon concentration mechanisms .

The substrate binding pocket architecture plays a crucial role in determining these kinetic properties. Molecular modeling studies indicate that small structural differences in the binding site, particularly single atom and functional group substitutions, can significantly alter substrate preference and reaction rates .

What structural features determine ndhA's catalytic mechanism and efficiency?

The catalytic mechanism and efficiency of ndhA are determined by several critical structural features that facilitate electron transfer from NAD(P)H to plastoquinone:

The nucleotide binding domain contains a highly conserved Rossmann fold motif (GXGXXG) that forms the binding pocket for the NAD(P)H substrate. X-ray crystallography and molecular modeling studies of related quinone oxidoreductases have revealed that the optimal distance between the flavin hydride donor site and the quinone acceptor site is approximately 3.5-4.0 Å for efficient electron transfer . This spatial arrangement is critical for catalysis, as even small deviations can significantly alter reaction rates.

The substrate specificity pocket includes several key residues that determine preference between NADH and NADPH. Typically, the presence of positively charged residues (Arg, Lys) at specific positions favors interaction with the additional 2'-phosphate group in NADPH, while negatively charged residues at these positions favor NADH binding. Site-directed mutagenesis studies have demonstrated that single amino acid substitutions in this region can shift substrate preference by altering Km ratios for NADPH:NADH by up to 50-fold .

How does ndhA activity contribute to plant stress responses and adaptation mechanisms?

The chloroplastic ndhA protein plays pivotal roles in plant stress adaptation, particularly through its contributions to alternative electron transport pathways:

Under drought stress conditions, ndhA-containing NDH complex activity increases significantly, enhancing cyclic electron flow around Photosystem I. This process generates additional ATP without producing NADPH, helping maintain optimal ATP:NADPH ratios for metabolic processes when CO2 assimilation is limited by stomatal closure. Experimental data from soybean plants under water limitation shows up to a 3-fold increase in NDH complex activity, correlating with improved water use efficiency and photosynthetic performance .

During high light stress, the NDH complex contributes to photoprotection through several mechanisms. By accepting electrons from the stromal pool, it prevents over-reduction of the electron transport chain and subsequent formation of reactive oxygen species. Metabolic flux analysis indicates that under high excitation pressure, increased NDH activity correlates with altered flux distribution in the tricarboxylic acid cycle and oxidative pentose phosphate pathway, suggesting coordinated metabolic adaptation to stress conditions .

Temperature stress adaptation also involves ndhA-mediated processes. Under low temperature, the NDH complex helps maintain thylakoid energization when enzyme-catalyzed reactions slow down. Conversely, during heat stress, it contributes to dissipating excess excitation energy when carbon assimilation is inhibited. Research shows that heat-tolerant varieties often exhibit enhanced NDH complex stability and activity compared to heat-sensitive lines .

What evidence exists for post-translational regulation of ndhA activity in response to environmental cues?

Substantial evidence indicates that ndhA activity is dynamically regulated through post-translational modifications that enable rapid responses to changing environmental conditions:

Phosphorylation represents a major regulatory mechanism for ndhA function. Phosphoproteomic analyses have identified multiple phosphorylation sites in the stromal-exposed loops of ndhA that change in phosphorylation status in response to light intensity and quality. Experimental evidence indicates that during transition from low to high light, ndhA phosphorylation increases by approximately 40% within 15 minutes, coinciding with enhanced NDH complex activity. These phosphorylation events are likely mediated by chloroplast casein kinase II and stromal thylakoid-associated kinases .

Redox regulation through thioredoxin systems provides another layer of control. Conserved cysteine residues in ndhA can form regulatory disulfide bonds that influence protein conformation and activity. Under high light conditions, increased thioredoxin activity leads to reduction of these disulfides, resulting in conformational changes that enhance electron transfer efficiency. This redox-dependent regulation allows rapid adjustment of cyclic electron flow rates according to photosynthetic electron transport chain redox state .

Protein-protein interactions dynamically modulate ndhA function within the larger NDH complex. Co-immunoprecipitation studies have demonstrated that ndhA associates with different partner proteins depending on environmental conditions. For example, interaction with PGR5/PGRL1 proteins increases under high light, coordinating different cyclic electron flow pathways. Additionally, chaperone proteins like cpHSP70 interact with ndhA during stress responses, contributing to complex stability and assembly .

What are the key considerations for experimental design when studying ndhA function in different systems?

Designing rigorous experiments to study ndhA function requires careful consideration of system-specific factors and methodological approaches:

For in vivo studies using intact plants or isolated chloroplasts, several critical factors must be controlled:

  • Light history of plant material (acclimation to specific light regimes)

  • Developmental stage standardization (leaf age and position)

  • Growth conditions (temperature, humidity, photoperiod)

  • Appropriate genetic controls (wild-type, known mutants affecting related pathways)

  • Time-resolved measurements to capture dynamic responses

When using chlorophyll fluorescence techniques to assess NDH complex activity in vivo, researchers should implement this methodology:

  • Dark-adapt samples for 20-30 minutes to fully oxidize plastoquinone pool

  • Apply actinic light (typically 500 μmol m⁻² s⁻¹) for 5 minutes

  • Monitor post-illumination chlorophyll fluorescence rise in darkness

  • Include PSII inhibitors (DCMU) in parallel samples to isolate NDH-dependent signals

  • Calculate initial slope of fluorescence rise as a quantitative measure of NDH activity

For in vitro studies with isolated proteins or membrane preparations, different considerations apply:

  • Detergent selection and concentration are critical for maintaining native-like activity

  • Lipid composition significantly affects enzyme function (incorporate thylakoid lipids)

  • pH and ionic strength must mimic stromal conditions (pH 7.8-8.2, 50-100 mM salt)

  • Control for protein oxidation during isolation (use anaerobic conditions, reducing agents)

  • Include appropriate electron donors and acceptors at physiologically relevant concentrations

The exploratory data analysis (EDA) approach is particularly valuable for screening experiments investigating multiple factors affecting ndhA activity. This approach emphasizes data visualization before formal hypothesis testing, helping identify unexpected patterns and interactions between experimental factors .

What statistical approaches are most appropriate for analyzing ndhA activity data from different experimental designs?

The statistical approach for analyzing ndhA activity data should be tailored to the specific experimental design and research questions:

For factorial experimental designs commonly used in enzymatic studies, two-way or multi-way ANOVA is appropriate to assess main effects and interactions between factors. Based on the exploratory data analysis approach described in reference , for 2ᵏ factorial designs:

  • Generate effects plots to visualize the impact of individual factors

  • Construct normal probability plots of effects to identify statistically significant factors

  • Analyze residuals to verify model assumptions (normality, homoscedasticity)

  • Calculate interaction terms to understand synergistic or antagonistic effects

When analyzing enzyme kinetics data for ndhA:

  • Apply non-linear regression for fitting Michaelis-Menten or other kinetic models

  • Use linearization methods (Lineweaver-Burk, Eadie-Hofstee) for visual analysis

  • Report confidence intervals for Km and Vmax, not just point estimates

  • Consider model comparison using Akaike Information Criterion (AIC) or Bayesian Information Criterion (BIC) when testing non-standard kinetic models

For time-series data common in photosynthetic measurements:

  • Implement repeated measures ANOVA or mixed-effects models

  • Calculate area under the curve (AUC) for activity profiles over time

  • Apply principal component analysis for multivariate time-series data

  • Use autocorrelation correction methods when appropriate

Statistical power considerations are essential for robust experimental design:

  • Conduct a priori power analysis to determine appropriate sample sizes

  • Target a statistical power of 0.8 (80% probability of detecting an effect if present)

  • Estimate effect sizes based on preliminary data or literature values

  • Consider non-parametric alternatives when normality assumptions are violated

A typical workflow for analyzing ndhA activity under different conditions would include testing data for normality (Shapiro-Wilk test), homogeneity of variances (Levene's test), applying the appropriate ANOVA model with post-hoc comparisons, and calculating effect sizes to quantify the magnitude of observed differences .

How can site-directed mutagenesis be optimized to study structure-function relationships in ndhA?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in ndhA, but requires strategic planning and optimization:

Strategic selection of mutation sites should be guided by:

  • Multiple sequence alignments identifying conserved residues across species

  • Homology modeling to predict residues involved in cofactor binding

  • Bioinformatic prediction of functional domains and regulatory sites

  • Known post-translational modification sites (phosphorylation, redox-active cysteines)

When designing mutations, researchers should consider multiple types of amino acid substitutions:

  • Conservative substitutions that maintain similar chemical properties to test structural requirements

  • Non-conservative substitutions to test functional hypotheses

  • Alanine scanning of specific domains to identify essential residues

  • Introduction or removal of post-translational modification sites to test regulatory mechanisms

Methodological optimization for chloroplast-targeted membrane proteins like ndhA includes:

  • Codon optimization for the chosen expression system

  • Two-step PCR approach for difficult templates with high GC content

  • Gibson Assembly for complex modifications requiring multiple mutations

  • Inclusion of epitope tags that minimally impact protein function

Research on related quinone oxidoreductases has demonstrated that even single atom substitutions can significantly alter enzyme activity and substrate specificity. Studies found correlations between kinetic parameters (Km) and the molecular-docking-derived distance between flavin hydride donor site and quinone hydride acceptor site . This provides a methodological framework for similar structure-function studies with ndhA, suggesting key positions that might influence catalytic efficiency.

What approaches are most effective for studying ndhA's integration into chloroplast electron transport networks?

Understanding ndhA's integration into chloroplast electron transport networks requires multifaceted approaches that span from molecular to systems levels:

For real-time monitoring of electron flow dynamics:

  • Dual PAM fluorometry enables simultaneous measurement of PSI and PSII activities

  • P700 absorbance kinetics (at 830 nm minus 875 nm) reveal PSI oxidation-reduction dynamics

  • Electrochromic shift (ECS) measurements track thylakoid membrane potential changes

  • NADPH fluorescence monitoring provides insights into stromal redox state

Advanced structural biology techniques reveal physical integration mechanisms:

  • Cryo-electron microscopy of NDH complex under different activation states

  • Single-particle analysis captures conformational changes during electron transport

  • Cross-linking mass spectrometry maps dynamic protein interactions

  • Hydrogen-deuterium exchange mass spectrometry detects conformational dynamics

Systems biology approaches connect ndhA function to broader metabolic networks:

  • Transcriptomic profiling under varying light and stress conditions identifies co-regulated genes

  • Metabolic flux analysis using ¹³C-labeling tracks carbon allocation patterns

  • Genome-scale metabolic modeling incorporates ndhA activity into whole-plant metabolism

  • Multi-omics data integration combines proteomics, metabolomics, and fluxomics

Reference provides valuable insights into metabolic modeling approaches, describing how genome-scale metabolic models of soybean can highlight metabolic fluxes. This approach has been used to predict NADPH production and consumption pathways, revealing that in soybean cotyledons, 55% of NADPH was produced by cytosolic and mitochondrial isocitrate dehydrogenase during early seedling development, with significant contributions from malic enzyme and oxidative pentose phosphate pathway . Similar approaches could be applied to understand how ndhA activity influences broader electron transport and metabolic networks.

What emerging technologies might advance our understanding of ndhA regulation and function?

Several emerging technologies hold promise for deepening our understanding of ndhA regulation and function in photosynthetic electron transport:

Optogenetic tools adapted for chloroplast proteins could revolutionize studies of ndhA function by:

  • Enabling precise temporal control of ndhA activity using light-sensitive domains

  • Allowing reversible protein-protein interaction control in specific chloroplast compartments

  • Creating conditional protein degradation systems to study loss-of-function phenotypes

  • Developing real-time activity reporters based on conformational changes

CRISPR/Cas technologies are evolving to provide unprecedented genetic manipulation capabilities:

  • Base editing and prime editing for precise single nucleotide modifications without double-strand breaks

  • CRISPR interference (CRISPRi) for tunable gene expression regulation

  • CRISPR activation (CRISPRa) for controlled overexpression studies

  • Multiplex editing for simultaneously targeting multiple genes in electron transport pathways

Advanced imaging techniques are improving visualization of dynamic processes:

  • Super-resolution microscopy techniques (STORM, PALM) for sub-diffraction imaging of protein complexes

  • Label-free imaging methods using stimulated Raman scattering microscopy

  • Correlative light and electron microscopy combining functional and structural information

  • Live-cell imaging approaches adaptable to chloroplast proteins

Integration of artificial intelligence and machine learning approaches offers new analytical capabilities:

  • Prediction of protein-protein interaction networks involving ndhA

  • Modeling of electron flow dynamics under fluctuating environmental conditions

  • Pattern recognition in complex multi-omics datasets

  • Design of novel ndhA variants with enhanced properties through in silico evolution

These technologies, particularly when used in combination, have the potential to address longstanding questions about how ndhA activity is regulated in response to environmental changes and how it coordinates with other components of photosynthetic electron transport.

How might synthetic biology approaches be used to engineer ndhA for improved photosynthetic efficiency?

Synthetic biology offers promising avenues for engineering ndhA to enhance photosynthetic efficiency through several strategic approaches:

Rational protein engineering strategies can target specific aspects of ndhA function:

  • Modification of catalytic residues to increase electron transfer rates

  • Engineering substrate binding sites for altered NADH/NADPH preference

  • Reducing product inhibition through structural modifications

  • Enhancing protein stability under temperature extremes

Directed evolution approaches provide powerful methods for optimizing ndhA properties:

  • Error-prone PCR to generate diverse mutant libraries

  • Selection systems based on growth under fluctuating light conditions

  • Compartmentalized self-replication for high-throughput screening

  • Combining rational design with evolution to focus mutation libraries on promising regions

Chimeric protein design offers creative solutions for functional enhancement:

  • Domain swapping with homologs from extremophile organisms

  • Creation of fusion proteins with complementary electron transport components

  • Integration of regulatory domains from other proteins

  • Minimal functional unit determination and optimization

Genome-scale metabolic modeling can guide synthetic biology efforts by:

  • Predicting system-wide effects of altered ndhA activity

  • Identifying optimal ATP:NADPH ratios for different environmental conditions

  • Suggesting companion modifications to maximize benefits of enhanced ndhA function

  • Modeling flux distributions under various stress scenarios

Research on soybean metabolism provides insights into how alterations in ATP:NADPH ratios affect various metabolic pathways, which could guide engineering efforts. For example, varying the ATP:NADPH maintenance ratio from 1:1 to 10:1 significantly affects tricarboxylic acid cycle flux and activities of enzymes like NADP-dependent malic enzyme . This knowledge would be valuable when designing ndhA variants with modified activities to achieve optimal energy balance in photosynthetic systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.