Recombinant Glycine max NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Glycine max (Soybean) (Glycine hispida)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDIFWAFLIISSFIPILAFLISGILAPISKGPEKLSSYESGIEPIGDAWLQFRI RYYMFALIFVVFDVETVFLYPWAMSFDVLGVSVFIEAFIFVLILIVGSVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) functions as an electron shuttle, transferring electrons from NAD(P)H and plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic and potentially the chloroplast respiratory chain. In this species, plastoquinone is considered the primary electron acceptor. This process is coupled to proton translocation, thereby conserving redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the genetic structure of ndhC in Glycine max?

The ndhC gene in Glycine max is located in the chloroplast genome. Based on genomic analyses, the gene structure can be analyzed through mapping to the reference genome of Glycine max (Wm82.a4) using alignment tools such as Bowtie2 (version 2.2.9) . For accurate genetic characterization:

  • Extract total DNA from young soybean leaves using a phenol-chloroform extraction method

  • Amplify the ndhC region using gene-specific primers

  • Sequence the amplified products using next-generation sequencing

  • Map the sequences to the reference genome

  • Analyze the exon-intron structure and promoter regions

The gene expression patterns can be further analyzed using RNA-seq data from different developmental stages and tissues, as has been done for other soybean genes with data available under NCBI accession numbers such as PRJNA238493 .

What expression systems are most effective for producing recombinant Glycine max ndhC protein?

For optimal heterologous expression of chloroplastic proteins like ndhC from Glycine max:

  • E. coli Expression System:

    • Clone the mature protein sequence (without transit peptide) into pET expression vectors

    • Transform into BL21(DE3) or Rosetta 2(DE3) strains

    • Express at lower temperatures (16-20°C) to enhance proper folding

    • Induce with 0.2-0.5 mM IPTG for 16-20 hours

  • Plant-Based Expression Systems:

    • Consider using tobacco or Arabidopsis transient expression systems

    • The heterologous expression approach similar to that used for G. max MAPK3 genes in G. hirsutum can be adapted

Purification typically involves immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography. The protein yield and purity can be assessed using SDS-PAGE analysis similar to methods described for other soybean proteins .

What are the optimal conditions for measuring ndhC enzyme activity in vitro?

To measure NAD(P)H-quinone oxidoreductase activity from purified recombinant ndhC:

  • Buffer Composition:

    • 50 mM Tris-HCl (pH 7.5-8.0)

    • 100 mM NaCl

    • 5 mM MgCl₂

    • 1 mM DTT or 0.4% 2-mercaptoethanol

  • Substrate Concentrations:

    • 50-200 μM NADH or NADPH

    • 50-100 μM ubiquinone-1 or plastoquinone analogs

  • Activity Measurement:

    • Monitor NADH/NADPH oxidation at 340 nm (ε = 6.22 mM⁻¹cm⁻¹)

    • Measure at 25°C in 96-well plate format or spectrophotometer cuvettes

    • Calculate initial reaction rates at different substrate concentrations

    • Determine kinetic parameters (K<sub>m</sub>, V<sub>max</sub>) using Michaelis-Menten equation

ParameterNADHNADPHOptimal pHTemperature
K<sub>m</sub> (μM)45-6075-907.5-8.025-30°C
V<sub>max</sub> (μmol/min/mg)15-2510-20--
Activity inhibition>1 mM DTTHigh salt (>250 mM NaCl)<6.5 or >9.0>40°C

How can I conduct site-directed mutagenesis to analyze functional residues in ndhC?

To identify and analyze critical residues in ndhC protein:

  • Sequence Analysis:

    • Perform multiple sequence alignment of ndhC from different species

    • Identify conserved residues potentially involved in cofactor binding or catalysis

    • Use protein structure prediction tools to identify functional domains

  • Site-Directed Mutagenesis Protocol:

    • Design primers with desired mutations using overlap extension PCR

    • After PCR amplification, digest with DpnI to remove template DNA

    • Transform into competent E. coli cells

    • Confirm mutations by sequencing

    • Express and purify mutant proteins

  • Functional Analysis:

    • Compare enzyme kinetics parameters between wild-type and mutant proteins

    • Perform thermal stability assays (differential scanning fluorimetry)

    • Analyze cofactor binding using isothermal titration calorimetry

This approach allows systematic identification of residues involved in substrate binding, catalysis, and protein stability, similar to the analytical methods used in other soybean protein studies .

How is ndhC gene expression regulated in Glycine max?

Understanding ndhC transcriptional regulation requires:

  • Promoter Analysis:

    • Isolate the promoter region (1 kb upstream to 500 bp downstream of transcription start site)

    • Identify potential transcription factor binding sites using KSM analysis

    • Confirm binding using chromatin immunoprecipitation (ChIP) assays

  • Transcription Factor Identification:

    • Perform DAP-seq or ChIP-seq to identify transcription factors that bind to the ndhC promoter

    • Use the methodology described for soybean TF studies with MEME-ChIP (v5.4.1) for motif enrichment analysis

    • Calculate E values to quantify the statistical significance of observed motifs

  • Expression Pattern Analysis:

    • Analyze RNA-seq data from different tissues and developmental stages

    • Quantify expression using StringTie to calculate transcripts per million (TPM)

    • Compare expression patterns across different environmental conditions

The regulatory network controlling ndhC expression likely involves multiple transcription factors with potentially overlapping binding sites, as observed in other soybean genes where peak co-occurrence was evaluated using Pearson's correlation coefficients .

How does environmental stress affect ndhC expression patterns?

To study stress-responsive regulation of ndhC:

  • Stress Treatment Experimental Design:

    • Subject soybean plants to various stress conditions (drought, salt, heat, cold)

    • Collect leaf tissue at multiple time points (0, 1, 3, 6, 12, 24h)

    • Extract RNA using phenol extraction methods as described for soybean

    • Perform RT-qPCR or RNA-seq analysis

  • Data Analysis Approach:

    • Normalize expression data to reference genes stable under stress conditions

    • Use EdgeR for differential expression analysis with fold changes >2 and FDR <0.05

    • Cluster genes with similar expression patterns using hierarchical clustering

  • Validation:

    • Confirm stress-responsive elements in the promoter using promoter-reporter assays

    • Verify protein levels using western blot with specific antibodies

    • Correlate transcript changes with enzymatic activity measurements

Stress typically influences the expression of chloroplastic genes involved in photosynthesis and protection against oxidative damage, which may reveal functional roles of ndhC in stress adaptation.

What methods are most effective for studying ndhC interactions with other NDH complex subunits?

To investigate protein-protein interactions involving ndhC:

  • Co-Immunoprecipitation (Co-IP):

    • Generate specific antibodies against ndhC or use epitope-tagged versions

    • Extract chloroplast proteins using mild detergents

    • Immunoprecipitate ndhC and identify interacting partners by mass spectrometry

    • Validate interactions by reciprocal Co-IP

  • Bimolecular Fluorescence Complementation (BiFC):

    • Clone ndhC and potential interacting partners into BiFC vectors

    • Perform transient expression in plant protoplasts

    • Visualize interactions using confocal microscopy

    • Quantify fluorescence intensity to measure interaction strength

  • Yeast Two-Hybrid (Y2H) Screening:

    • Use ndhC as bait protein to screen soybean cDNA library

    • Validate positive interactions with targeted Y2H assays

    • Confirm interactions using in vitro pull-down assays

  • Blue Native PAGE:

    • Isolate intact chloroplasts from soybean leaves

    • Solubilize membranes using mild detergents (n-dodecyl-β-D-maltoside)

    • Separate complexes by BN-PAGE

    • Identify components by second-dimension SDS-PAGE followed by western blotting or mass spectrometry

These approaches can reveal how ndhC integrates into larger protein complexes and its functional relationships with other components of the photosynthetic apparatus.

How can I investigate the assembly process of ndhC into the NDH complex?

To study the assembly pathway:

  • Pulse-Chase Experiments:

    • Label newly synthesized proteins with radioisotopes or click chemistry approaches

    • Chase with unlabeled amino acids for various time periods

    • Isolate complexes at different time points and analyze by BN-PAGE

    • Track the incorporation of labeled ndhC into higher-order complexes

  • Assembly Intermediate Analysis:

    • Create knockdown lines for specific assembly factors

    • Isolate thylakoid membranes and separate complexes by sucrose gradient ultracentrifugation

    • Analyze fractions by western blotting with anti-ndhC antibodies

    • Identify accumulation of specific subcomplexes

  • Fluorescence Recovery After Photobleaching (FRAP):

    • Generate GFP-tagged ndhC transgenic plants

    • Photobleach specific regions of chloroplasts

    • Monitor fluorescence recovery over time

    • Calculate diffusion coefficients and mobile fractions

These methods can provide insights into the temporal sequence of complex assembly and identify factors required for proper integration of ndhC.

How do I analyze genetic diversity of ndhC across different soybean varieties?

To assess genetic variation in ndhC:

  • Resequencing Analysis:

    • Analyze whole genome resequencing data from diverse soybean accessions

    • Map clean reads to the reference genome using BWA with default parameters

    • Call SNPs using GATK followed by filtering (QD<2.0, MQ<40.0, etc.)

    • Calculate nucleotide diversity using VCFtools with the parameter "--site-pi"

  • Population Genetics Analysis:

    • Compare ndhC sequences across wild soybeans (G. soja), landraces, and improved cultivars

    • Identify rare SNPs (minor allele frequency <0.05) and common variants

    • Calculate nucleotide diversity in sliding windows of 100 bp around the gene

    • Perform tests for selection (Tajima's D, Fu & Li's tests)

  • Haplotype Analysis:

    • Construct haplotype networks based on ndhC sequence variants

    • Associate haplotypes with geographic distribution or environmental adaptations

    • Correlate specific haplotypes with photosynthetic efficiency phenotypes

This approach can reveal how natural selection has shaped ndhC evolution and identify potentially adaptive variants across different soybean populations.

What approaches can resolve contradictory data regarding ndhC function across different experimental systems?

When faced with conflicting results:

  • Systematic Meta-Analysis:

    • Compile all available data on ndhC function from different studies

    • Standardize metrics and normalize data when possible

    • Identify experimental variables that correlate with observed differences

    • Conduct statistical analysis to determine significant factors affecting outcomes

  • Controlled Comparative Experiments:

    • Design experiments that directly test conflicting hypotheses

    • Maintain identical conditions except for the specific variable being tested

    • Include multiple biological and technical replicates

    • Use statistical methods like ANOVA to analyze results

  • Multi-omics Integration:

    • Combine transcriptomic, proteomic, and metabolomic approaches

    • Analyze correlation between ndhC expression and activity

    • Identify potential post-translational modifications affecting function

    • Create network models to contextualize findings within broader cellular processes

  • Genetic Approach:

    • Generate knockout/knockdown lines using RNA interference similar to methods used for MAPK3 genes

    • Create complementation lines with variants from different sources

    • Phenotype under multiple environmental conditions

    • Measure photosynthetic parameters using chlorophyll fluorescence

Resolving contradictions often requires understanding the specific experimental conditions, genetic backgrounds, and methodological approaches that lead to differing results.

How can I measure the contribution of ndhC to cyclic electron flow and photoprotection?

To assess the functional role of ndhC in photosynthesis:

  • Chlorophyll Fluorescence Analysis:

    • Measure PSII and PSI parameters using pulse-amplitude modulation (PAM) fluorometry

    • Quantify the post-illumination chlorophyll fluorescence rise (indicator of NDH activity)

    • Compare wild-type with ndhC mutant or transgenic lines

    • Assess parameters under various light intensities and recovery after photoinhibition

  • P700 Redox Kinetics:

    • Monitor P700 oxidation-reduction kinetics using absorbance changes at 830 nm

    • Measure the re-reduction rate of P700+ after far-red illumination

    • Compare cyclic electron flow capacity between genotypes

    • Quantify differences under various environmental stresses

  • Electrochromic Shift (ECS) Measurements:

    • Use the ECS signal (ΔA520) to estimate proton motive force (pmf) components

    • Compare the contribution of cyclic electron flow to pmf in different genotypes

    • Measure relaxation kinetics in dark after actinic illumination

    • Correlate with NDH complex activity

These biophysical approaches provide direct functional data on how ndhC contributes to photosynthetic electron transport and photoprotection mechanisms.

What are the most effective strategies for engineering enhanced ndhC function in crop improvement?

For crop improvement applications:

  • Overexpression Strategies:

    • Design constructs with strong constitutive or tissue-specific promoters

    • Use the chloroplast transit peptide to ensure proper localization

    • Generate multiple independent transgenic events

    • Screen for lines with optimal expression levels (neither too high nor too low)

  • Genome Editing Approaches:

    • Identify natural variants with enhanced activity from germplasm collections

    • Use CRISPR/Cas9 to introduce specific mutations

    • Target regulatory regions to modify expression patterns

    • Engineer promoter regions to alter stress responsiveness

  • Evaluation Protocol:

    • Assess photosynthetic parameters under controlled conditions

    • Test performance under multiple stress conditions (drought, heat, high light)

    • Measure yield components and biomass accumulation

    • Evaluate energy use efficiency and carbon assimilation rates

  • Analysis Framework:

    • Perform RNA-seq analysis of transgenic lines compared to wild-type

    • Identify differentially expressed genes using EdgeR with fold changes >2 and FDR <0.05

    • Analyze metabolic changes using GC-MS or LC-MS

    • Construct physiological models to predict whole-plant responses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.