Recombinant Glycine max NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Glycine max NAD(P)H-Quinone Oxidoreductase Subunit 4L (ndhE)

Recombinant Glycine max NAD(P)H-quinone oxidoreductase subunit 4L (ndhE), chloroplastic, is a bioengineered protein derived from soybean (Glycine max) chloroplasts. It belongs to the NAD(P)H dehydrogenase complex (NDH), which participates in photosynthetic cyclic electron transport and chlororespiration in thylakoid membranes . This subunit is critical for electron transfer and proton translocation, contributing to energy conservation in chloroplasts .

Key Features of ndhE

The recombinant ndhE protein is produced via cell-free expression systems, ensuring high purity (≥85% by SDS-PAGE) and minimal contamination . Its sequence spans 101 amino acids (1–101 aa), with a molecular weight of 11,337 Da . The protein is stored in glycerol-containing buffers at -20°C to preserve stability .

Sequence and Molecular Architecture

The primary sequence of ndhE includes hydrophobic regions critical for membrane integration and electron transfer. Key residues include:

  • N-terminal motif: MMFEHVLFLSVYLFSIGIYG

  • Central hydrophobic domains: LICLELILNS INLNLVTFSD LFDSRQLKGD

  • C-terminal region: LSSIHRNRKS TRINQSNFLN

This structure aligns with chloroplastic NDH subunits, which form part of a larger complex mediating electron flow from ferredoxin (Fd) to plastoquinone .

ParameterValueSource
Gene NamendhE
Sequence Length101 amino acids (1–101 aa)
Molecular Weight11,337 Da
Host SystemCell-free expression
Purity≥85% (SDS-PAGE)

Role in Electron Transport

ndhE is a peripheral subunit of the NDH complex, which shuttles electrons from Fd to plastoquinone, bypassing the main linear electron transport chain. This cyclic pathway protects against photoinhibition and enhances ATP synthesis under stress conditions . Unlike mitochondrial Complex I, chloroplast NDH lacks proton-pumping activity but stabilizes photosystem I (PSI) in high-light environments .

Interaction with Accessory Proteins

The assembly of subcomplex A (containing ndhH, I, J, K, L, M, N, O) requires stromal factors such as CRR41 and CRR42. These proteins facilitate iron-sulfur cluster incorporation and subunit folding, ensuring proper NDH-PSI supercomplex formation .

Cell-Free Expression System

Recombinant ndhE is synthesized in vitro using cell-free systems, avoiding host organism limitations. This method allows precise control over reaction conditions, optimizing yield and minimizing post-translational modifications .

Studies on NDH Complex Assembly

Recombinant ndhE has been used to investigate assembly intermediates of subcomplex A. Mutant analyses (crr41, crr42) revealed that stromal proteins CRR41 and CRR42 are essential for ndhE stabilization and NDH activity .

Chloroplast Engineering

While not directly linked to ndhE, chloroplast genome engineering (e.g., expressing human proteins like FVIII or ACE2) highlights the importance of chloroplast-targeted recombinant proteins in biotechnology .

ndhE vs. Other NDH Subunits

ParameterndhEndhG (Subunit 6)
FunctionPeripheral subunit, electron transferCore subunit, plastoquinone binding
Molecular Weight11,337 Da~20,000 Da (estimated)
Sequence FeaturesHydrophobic domains for membrane integrationConserved motifs for quinone interaction

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand that you may have specific requirements. If so, please indicate your preferred format when placing your order and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice packaging, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, serving as a reference point for your convenience.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize the development of your specified tag.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Glycine max (Soybean) (Glycine hispida)
Target Names
ndhE
Target Protein Sequence
MIFEHALVLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNINLVTFSDFFDSRQLKGN IFSIFVIAIAAAEAAIGPAIVSSIYRNRKSTRINQSNLLNK
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H:plastoquinone to quinones within the photosynthetic chain, and potentially within a chloroplast respiratory chain. The enzyme's immediate electron acceptor in this species is thought to be plastoquinone. It couples the redox reaction to proton translocation, effectively conserving redox energy within a proton gradient.
Database Links

KEGG: gmx:3989359

Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does the structure of Glycine max ndhE compare to similar proteins in other organisms?

While the specific structure of Glycine max ndhE has not been fully characterized in the provided search results, structural insights can be inferred from related proteins. NAD(P)H:quinone oxidoreductases have been studied in detail in mammals, with crystal structures resolved for human and mouse variants at 1.7-Å and 2.8-Å resolution respectively .

Based on comparative analysis, we can expect that Glycine max ndhE would share some structural features with other NAD(P)H-quinone oxidoreductases, including:

  • A flavin binding domain containing FAD as a prosthetic group

  • A substrate binding pocket that accommodates quinones

  • A NAD(P)H binding site

  • Specific residues that facilitate electron transfer

The plant chloroplastic ndhE likely has structural adaptations specific to its role in photosynthetic electron transport, distinguishing it from the mammalian counterparts that function primarily in detoxification pathways. The protein would be expected to have transmembrane domains for integration into the thylakoid membrane system.

What experimental approaches are commonly used to study ndhE function in plants?

Several methodological approaches are employed to study ndhE function in plants, including Glycine max:

  • Gene expression analysis: Quantitative PCR and RNA-Seq to measure transcript levels of ndhE under various conditions. This approach has been used to demonstrate altered expression of genes during stress responses, similar to the observed changes in Gm-CCA1-1 expression during nematode infection .

  • Protein localization: Immunolocalization and GFP-fusion techniques to confirm the chloroplastic localization and membrane association of ndhE.

  • Genetic engineering approaches: RNAi or CRISPR-based knockdown/knockout systems to reduce expression and assess functional consequences, similar to approaches used for studying defense-related genes in Glycine max .

  • Biochemical assays: In vitro enzyme activity assays using recombinant protein to measure the rate of NAD(P)H-dependent quinone reduction, similar to those performed with mammalian NAD(P)H:quinone oxidoreductases .

  • Physiological measurements: Chlorophyll fluorescence analysis to assess impacts on photosynthetic electron flow when ndhE function is altered.

How does the kinetic mechanism of Glycine max ndhE differ from mammalian NAD(P)H:quinone oxidoreductases?

The kinetic mechanism of NAD(P)H:quinone oxidoreductases in mammals follows a ping-pong mechanism, with distinct substrate binding and product release steps. In human QR1, after reducing the flavin, NAD(P)+ leaves the catalytic site, allowing the substrate to bind at the vacated position . The structural basis for this mechanism involves specific residues like Tyrosine-128 and the loop spanning residues 232-236, which close the binding site and partially occupy the space left vacant by the departing molecule .

For Glycine max ndhE, we can hypothesize several key differences in kinetic mechanism:

  • Substrate specificity: The plant enzyme likely has evolved to interact with plastoquinone rather than the diverse quinones encountered by mammalian enzymes.

  • Electron donor preference: While mammalian enzymes can use both NADH and NADPH (with varying efficiencies), the plant chloroplastic enzyme may have a stronger preference for NADPH due to its abundance in chloroplasts during photosynthesis.

  • Regulatory mechanisms: The plant enzyme likely responds to light-dependent signals and may be integrated with other photosynthetic electron transport components.

  • Structural adaptations: The binding pocket architecture would be expected to reflect these functional specializations, potentially with different arrangements of key catalytic residues.

Experimental approaches to investigate these differences would include enzyme kinetics with various substrates, inhibitor studies, and site-directed mutagenesis of predicted catalytic residues.

What role might ndhE play in Glycine max defense responses against pathogens?

NAD(P)H-quinone oxidoreductase subunit 4L may contribute to defense responses in Glycine max through several potential mechanisms:

  • Reactive oxygen species (ROS) management: By efficiently transferring electrons to quinones, the enzyme could help regulate ROS levels during pathogen attack, contributing to both signaling and direct antimicrobial effects.

  • Integration with circadian defense responses: Studies have demonstrated that circadian clock components like CCA1-1 influence resistance against pathogens such as Heterodera glycines in soybean . The expression and activity of ndhE could be regulated by these clock components, linking photosynthetic function to timed defense responses.

  • Energy allocation during defense: During pathogen challenges, plants must balance energy between defense and growth. The ndhE protein, through its role in cyclic electron flow, could help maintain ATP production when linear electron flow is compromised during defense responses.

  • Cell wall reinforcement support: Studies on Glycine max defense against nematodes have revealed increased xyloglucan synthesis during resistance responses . The energy required for such cell wall modifications could be partially supported by ndhE activity.

Research approaches to investigate these roles would include comparing ndhE expression and protein activity in resistant versus susceptible Glycine max varieties during pathogen challenge, as well as analyzing the phenotypes of ndhE-modulated plants when exposed to pathogens.

How do post-translational modifications affect ndhE function in Glycine max?

Post-translational modifications (PTMs) likely play critical roles in regulating ndhE function in Glycine max, although specific data on these modifications is not provided in the search results. Based on knowledge of related proteins, several PTMs might be relevant:

  • Phosphorylation: Potential phosphorylation sites could regulate enzyme activity, complex assembly, or interaction with other proteins in response to changing environmental conditions or pathogen attack.

  • Redox regulation: Cysteine residues might undergo oxidation/reduction in response to chloroplast redox state, providing a mechanism to adjust enzyme activity according to photosynthetic conditions.

  • N-terminal processing: As a chloroplast-encoded protein, ndhE likely undergoes N-terminal processing after import into the chloroplast.

  • Protein-protein interactions: The integration of ndhE into the larger NAD(P)H dehydrogenase complex would involve specific interaction sites that might be regulated by modifications.

A methodological approach to study these modifications would include:

  • Immunoprecipitation followed by mass spectrometry to identify PTMs

  • Site-directed mutagenesis of potential modification sites

  • In vitro enzymatic assays comparing wild-type and modified proteins

  • Temporal analysis of modifications under different stress conditions

What are the optimal conditions for expressing recombinant Glycine max ndhE?

Based on available information for recombinant NAD(P)H-quinone oxidoreductase subunit 4L expression, the following methodological considerations should be taken into account:

  • Expression system: E. coli has been successfully used as a host for producing recombinant NAD(P)H-quinone oxidoreductase proteins . For Glycine max ndhE, codon optimization for E. coli expression may be necessary.

  • Protein formulation: The recombinant protein is typically prepared in liquid form containing glycerol for stability .

  • Temperature considerations: Expression at lower temperatures (16-20°C) after induction may improve proper folding and solubility.

  • Storage conditions: For optimal stability, store at -20°C for routine use, or at -80°C for extended storage . Repeated freeze-thaw cycles should be avoided, and working aliquots can be maintained at 4°C for up to one week .

  • Solubility enhancements: As a membrane-associated protein, solubility may be improved by using fusion tags such as MBP (maltose-binding protein) or by including mild detergents during purification.

  • Cofactor incorporation: To ensure proper folding and activity, addition of FAD during expression or purification may be necessary.

What analytical techniques are most effective for characterizing ndhE interactions with other components of the photosynthetic apparatus?

Several advanced analytical techniques can be employed to characterize the interactions of ndhE with other components of the photosynthetic apparatus:

  • Blue native PAGE: This technique allows separation of intact protein complexes and can reveal the integration of ndhE into larger complexes under different conditions.

  • Co-immunoprecipitation followed by mass spectrometry: This approach can identify proteins that directly interact with ndhE in vivo.

  • Förster resonance energy transfer (FRET): By creating fluorescent protein fusions, FRET can detect close physical interactions between ndhE and other photosynthetic components in living plant cells.

  • Cryo-electron microscopy: This technique can visualize the structure of the entire NAD(P)H dehydrogenase complex with ndhE in its native state.

  • Hydrogen-deuterium exchange mass spectrometry: This method can identify regions of ndhE that undergo conformational changes upon interaction with other proteins or substrates.

  • Surface plasmon resonance: For quantitative measurements of binding kinetics between purified ndhE and potential interacting partners.

These techniques complement each other to provide a comprehensive understanding of how ndhE functions within the larger context of photosynthetic electron transport.

How can researchers effectively design experiments to study the impact of environmental stresses on ndhE function?

When designing experiments to study the impact of environmental stresses on ndhE function in Glycine max, researchers should consider the following methodological approaches:

  • Stress treatment design:

    • Control environmental variables carefully (light intensity, temperature, humidity)

    • Apply stress treatments gradually to capture early adaptive responses

    • Include both acute and chronic stress exposures

    • Consider combination stresses that mimic field conditions

  • Multi-level analysis approach:

    • Transcript abundance (qPCR, RNA-Seq)

    • Protein levels (western blotting, proteomics)

    • Enzyme activity assays (spectrophotometric measurement of quinone reduction)

    • Electron transport rates (chlorophyll fluorescence)

    • Whole-plant physiological responses

  • Temporal resolution:

    • Capture rapid responses (minutes to hours) and long-term adaptations (days)

    • Consider circadian influences, as clock components have been shown to affect stress responses in Glycine max

  • Genetic resources:

    • Compare multiple Glycine max cultivars with varying stress tolerance

    • Utilize transgenic lines with altered ndhE expression

    • Consider CRISPR-modified lines with specific mutations in ndhE

  • Data integration strategies:

    • Correlate changes in ndhE expression/activity with physiological parameters

    • Use statistical approaches like principal component analysis to identify key variables

    • Develop predictive models of how ndhE function relates to stress tolerance

How might understanding ndhE function contribute to improving Glycine max resistance to biotic stresses?

Understanding ndhE function could contribute to improving Glycine max resistance to biotic stresses in several ways:

  • Enhanced energy management during pathogen attack: If ndhE plays a role in maintaining energetic homeostasis during pathogen challenge, enhancing its expression or activity could provide plants with additional resources to mount effective defense responses.

  • Integration with defense signaling pathways: Research on Glycine max defense against nematodes has revealed connections between circadian clock components and resistance . Understanding how ndhE may be regulated by these same pathways could reveal new intervention points.

  • ROS management strategies: Since NAD(P)H-quinone oxidoreductases affect redox balance, modulating ndhE function could help optimize the ROS signature during pathogen attack, potentially enhancing beneficial signaling while minimizing cellular damage.

  • Marker-assisted selection: Identification of natural variants of ndhE associated with enhanced pathogen resistance could provide genetic markers for breeding programs.

Experimental approaches to explore these applications would include:

  • Comparing ndhE sequence, expression, and activity between resistant and susceptible Glycine max varieties

  • Creating transgenic plants with modified ndhE expression and testing their pathogen responses

  • Analyzing metabolic changes in plants with altered ndhE function during pathogen challenge

What are the most promising directions for future research on Glycine max ndhE?

Several promising research directions for Glycine max ndhE warrant further investigation:

  • Structural biology approaches: Determining the high-resolution structure of Glycine max ndhE, both alone and as part of its native complex, would provide insights into its specific adaptations. This could build upon approaches used for human and mouse NAD(P)H:quinone oxidoreductases, where structures have been resolved at 1.7-Å and 2.8-Å resolution .

  • Systems biology integration: Exploring how ndhE function connects with broader metabolic and signaling networks, particularly under stress conditions. This would include identification of transcription factors regulating ndhE expression and metabolites affected by its activity.

  • Evolutionary analysis: Comparative studies across plant species could reveal how ndhE has evolved specialized functions in different photosynthetic contexts and environments.

  • Synthetic biology applications: Engineering ndhE with enhanced properties or novel regulatory elements could lead to plants with improved stress responses or photosynthetic efficiency.

  • Field-level phenotyping: Evaluating the performance of plants with natural or engineered ndhE variants under realistic field conditions would bridge the gap between molecular understanding and agricultural application.

  • Cross-talk with defense pathways: Deeper investigation of how ndhE function may contribute to defense responses, building on findings that plant defense systems in Glycine max involve complex regulatory networks including circadian components .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.