Recombinant Glycine max Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 1 (FAD2-1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Glycine max Omega-6 Fatty Acid Desaturase, Endoplasmic Reticulum Isozyme 1 (FAD2-1)

Recombinant Glycine max Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 1 (FAD2-1) is a genetically engineered protein derived from soybean (Glycine max) and produced in heterologous systems such as E. coli, yeast, or mammalian cells. This enzyme catalyzes the Δ12 desaturation of oleic acid (C18:1) to linoleic acid (C18:2), a critical step in fatty acid biosynthesis that regulates the polyunsaturated fatty acid (PUFA) content in plant oils . FAD2-1 is a seed-specific isoform of the FAD2 gene family, with two paralogs, FAD2-1A and FAD2-1B, differing by 24 amino acids but sharing >95% sequence identity . Mutations in these genes are linked to high oleic acid phenotypes in soybeans, making FAD2-1 a focal point for metabolic engineering to improve oil quality .

Key Features of Recombinant FAD2-1

AttributeDescriptionSource
Gene NameFAD2-1 (alias: FAD2-1A, FAD2-1B)
Host SystemsE. coli, yeast, baculovirus, mammalian cells
Purity≥85% (SDS-PAGE)
TagN-terminal His-tag (10xHis)
Protein LengthFull-length (1–387 residues)
FunctionΔ12 desaturation of oleic acid to linoleic acid (EC 1.14.19.-)

Role in Fatty Acid Metabolism

FAD2-1 is pivotal in determining seed oil composition:

  • Activity: Converts oleic acid (C18:1) to linoleic acid (C18:2) via a Δ12 desaturation reaction, utilizing NADH and cytochrome b5 as cofactors .

  • Seed-Specific Expression: Primarily active during seed development, with FAD2-1A and FAD2-1B transcripts accumulating in developing seeds .

  • Impact of Mutations: Disruptions in FAD2-1A or FAD2-1B (e.g., deletions, frame-shifts) reduce enzyme activity, increasing oleic acid content (e.g., >40% in mutants M23 and KK21) .

Experimental Uses

ApplicationMethodology/OutcomeSource
Enzyme Activity AssaysHeterologous expression in S. cerevisiae to measure linoleic acid production
Mutant ScreeningCEL I nuclease assays to detect SNPs (e.g., single-nucleotide deletions in KK21)
Structural StudiesSDS-PAGE, Western blotting to validate protein integrity and His-tag presence

Agricultural Implications

  • High-Oleic Soybeans: Engineering FAD2-1 knockouts via CRISPR or RNAi to enhance oleic acid (>80%) and reduce linoleic acid (<4%), improving oil stability .

  • Molecular Markers: Development of PCR-based markers for FAD2-1A/B mutations to streamline breeding programs .

Comparative Analysis of FAD2 Isoforms

IsoformExpression PatternMutation ImpactReference
FAD2-1ASeed-specificComplete deletion → oleic acid >40%
FAD2-1BSeed-specificFrame-shift → non-functional enzyme
FAD2-2Ubiquitous (cytoplasmic)No direct effect on seed oil composition

Challenges and Future Directions

  • Host Dependency: Recombinant FAD2-1 activity varies by host system (e.g., E. coli vs. mammalian cells), requiring optimization for functional assays .

  • Post-Translational Modifications: Phosphorylation of serine residues (e.g., Ser-185) may regulate enzyme activity, warranting further investigation .

  • Industrial Applications: Scalable production of recombinant FAD2-1 for in vitro fatty acid desaturation in biofuels or nutraceuticals .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please specify them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
FAD2-1; Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-387
Protein Length
full length protein
Species
Glycine max (Soybean) (Glycine hispida)
Target Names
FAD2-1
Target Protein Sequence
MGLAKETTMGGRGRVAKVEVQGKKPLSRVPNTKPPFTVGQLKKAIPPHCFQRSLLTSFSY VVYDLSFAFIFYIATTYFHLLPQPFSLIAWPIYWVLQGCLLTGVWVIAHECGHHAFSKYQ WVDDVVGLTLHSTLLVPYFSWKISHRRHHSNTGSLDRDEVFVPKPKSKVAWFSKYLNNPL GRAVSLLVTLTIGWPMYLAFNVSGRPYDSFASHYHPYAPIYSNRERLLIYVSDVALFSVT YSLYRVATLKGLVWLLCVYGVPLLIVNGFLVTITYLQHTHFALPHYDSSEWDWLKGALAT MDRDYGILNKVFHHITDTHVAHHLFSTMPHYHAMEATNAIKPILGEYYQFDDTPFYKALW REARECLYVEPDEGTSEKGVYWYRNKY
Uniprot No.

Target Background

Function
ER (microsomal) omega-6 fatty acid desaturase introduces the second double bond in the biosynthesis of 18:3 fatty acids, which are vital components of plant membranes. This enzyme is thought to utilize cytochrome b5 as an electron donor and act on fatty acids esterified to phosphatidylcholine and potentially other phospholipids.
Gene References Into Functions
  1. Mutation within the FAD2-1A gene is associated with high oleic acid content PMID: 21681491
Database Links

KEGG: gmx:547814

STRING: 3847.GLYMA10G42470.1

UniGene: Gma.18367

Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Strongly expressed in developing seeds.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.