Recombinant Glycine max Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 2 (FAD2-2)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Glycine max omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 2 (FAD2-2), is a genetically engineered enzyme derived from soybean (Glycine max). This membrane-bound desaturase catalyzes the conversion of oleic acid (18:1 Δ9) to linoleic acid (18:2 Δ9,12) by introducing a second double bond at the Δ12 position. Unlike its plastid-localized counterpart (FAD6), FAD2-2 operates in the endoplasmic reticulum (ER) and primarily utilizes phospholipids as substrates . It plays a critical role in polyunsaturated fatty acid (PUFA) biosynthesis, influencing membrane fluidity, stress responses, and seed oil composition .

Gene Family and Isoforms

The soybean FAD2 gene family comprises seven members across six chromosomes, with FAD2-2 existing as multiple isoforms:

  • FAD2-2A (Glyma.19G147300), FAD2-2B (Glyma.19G147400), FAD2-2C (Glyma.03G144500), FAD2-2D (Glyma.09G111900), and FAD2-2E (Glyma.15G195200) .

  • These isoforms share 52–97.4% sequence similarity, with FAD2-2B and FAD2-2C exhibiting constitutive expression in non-seed tissues .

Catalytic Activity

  • Recombinant FAD2-2 exhibits Δ12-desaturase activity, converting oleic acid to linoleic acid in yeast heterologous systems .

  • In soybean mutants, reduced FAD2 activity correlates with 18–36% decreases in linoleic acid and up to 50% increases in oleic acid (Table 2) .

Stress Adaptation

  • FAD2-2 enhances plant tolerance to cold and salt stress by increasing membrane lipid unsaturation, ensuring fluidity under adverse conditions .

  • Transgenic tobacco expressing sunflower FAD2 homologs showed improved salt tolerance due to elevated dienoic fatty acid levels .

Table 2: Fatty Acid Profiles in Soybean FAD2 Mutants

Fatty AcidWild-Type (%)FAD2-1A Mutant (%)FAD2-1B Mutant (%)
Oleic Acid23.450.948.7
Linoleic Acid53.128.330.1
Linolenic Acid6.86.56.4
Data adapted from EMS-mutagenized soybean populations .

Recombinant Expression and Applications

  • Heterologous Systems: FAD2-2 has been expressed in yeast (Saccharomyces cerevisiae) and Nicotiana benthamiana to study its enzymatic activity and substrate specificity .

  • Biotechnological Potential:

    • Oilseed Engineering: Modulating FAD2-2 expression could optimize PUFA content in soybean oil for nutritional or industrial uses .

    • Stress-Tolerant Crops: Overexpression in crops may improve resilience to abiotic stresses .

Research Advancements

  • Gene Editing: TILLING (Targeting Induced Local Lesions IN Genomes) screens identified missense mutations (e.g., FAD2-1A P284L) that reduce enzyme activity, enabling high-oleic soybean lines .

  • Regulatory Elements: The 5′UTR intron of FAD2-2 contains intron-mediated enhancement (IME) elements, boosting gene expression by up to 100-fold in transgenic systems .

Challenges and Future Directions

  • Functional Redundancy: Overlapping roles of FAD2-2 isoforms complicate targeted engineering .

  • Structural Dynamics: The enzyme’s hydrophobic active site and membrane localization hinder crystallographic studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your requirements.
Lead Time
Delivery timelines may vary depending on the purchasing method and location. For precise delivery estimates, please contact your local distributor.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
FAD2-2; Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-383
Protein Length
full length protein
Species
Glycine max (Soybean) (Glycine hispida)
Target Names
FAD2-2
Target Protein Sequence
MGAGGRTDVPPANRKSEVDPLKRVPFEKPQFSLSQIKKAIPPHCFQRSVLRSFSYVVYDL TIAFCLYYVATHYFHLLPGPLSFRGMAIYWAVQGCILTGVWVIAHECGHHAFSDYQLLDD IVGLILHSALLVPYFSWKYSHRRHHSNTGSLERDEVFVPKQKSCIKWYSKYLNNPPGRVL TLAVTLTLGWPLYLALNVSGRPYDRFACHYDPYGPIYSDRERLQIYISDAGVLAVVYGLF RLAMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHPALPHYTSSEWDWLRGALATVDRD YGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYRFDETPFVKAMWREAR ECIYVEPDQSTESKGVFWYNNKL
Uniprot No.

Target Background

Function
ER (microsomal) omega-6 fatty acid desaturase introduces the second double bond in the biosynthesis of 18:3 fatty acids, crucial components of plant membranes. It is believed to utilize cytochrome b5 as an electron donor and to act on fatty acids esterified to phosphatidylcholine and possibly other phospholipids.
Database Links

KEGG: gmx:547815

STRING: 3847.GLYMA03G30070.3

UniGene: Gma.5046

Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of FAD2-2 and how does it function biochemically?

FAD2-2 is a membrane-bound desaturase containing 6 transmembrane domains and 8 conserved histidine residues arranged in three distinct clusters (HXXXH, HXXHH, and HXXHH). These histidine clusters form iron-binding domains essential for the reduction of oxygen during the desaturation process . The enzyme is embedded in the endoplasmic reticulum membrane where it catalyzes the introduction of a second double bond in oleic acid (C18:1) to produce linoleic acid (C18:2).

Analysis of the amino acid sequence reveals that four hydrophobic residues (valine, alanine, leucine, valine) out of the eight amino acids in the third histidine cluster likely contribute to the formation of the active site interior. In the second histidine cluster, leucine residues are predominant . This specific arrangement of hydrophobic residues helps maintain the proper orientation of catalytic sites within the membrane environment.

How does FAD2-2 differ from other FAD isoforms in expression patterns?

The FAD2 gene family includes multiple isoforms that differ primarily in their expression patterns rather than sequence composition. FAD2-2 is classified as a housekeeping-type gene with constitutive expression patterns across different tissues, distinguishing it from seed-specific isoforms like FAD2-1B .

Studies in various plant species have revealed that:

  • FAD2-2 maintains consistent expression across different tissues with spatial and temporal regulation

  • Unlike seed-specific isoforms, FAD2-2 responds to environmental factors including temperature, light, and wounding

  • In olive (Olea europaea L.), FAD2-2 is highly expressed in mesocarp and seed during fruit ripening, correlating with linoleic acid biosynthesis patterns

  • Expression analysis shows FAD2-2 involvement in responses to drought, cold tolerance, and salt stress

What role does the 5'UTR intron play in FAD2-2 expression regulation?

The 5'UTR intron of FAD2-2 contains critical regulatory elements that significantly influence gene expression. Detailed analysis of this region has revealed:

  • The presence of Intron-Mediated Enhancement (IME) elements that boost gene expression

  • In olive FAD2-2, a 117-bp insertion including two long duplications not previously identified in other FAD2-2 genes

  • Various cis-acting regulatory elements including TATA box, CAAT box, TGACG-motif, and Box 1, which respond to abscisic acid and light

  • The proximity of the intron (11bp) to the translational start site, which is known to enhance gene expression

The collective impact of these elements suggests an evolutionary pathway toward enhanced expression rather than new functional diversification. The duplications likely contribute to adaptive regulation of fatty acid desaturation under varying environmental conditions .

How do SNPs in the FAD2-2 gene correlate with fatty acid composition?

Single nucleotide polymorphisms (SNPs) in the FAD2-2 gene show significant associations with variation in oleic and linoleic acid content in plant oils. Analysis of the 5'UTR intron sequence has identified:

SNP PositionAssociationPhenotypic Variation ExplainedCorrelation with Other SNPs
SNP23Increased oleic acid7-16% (depending on year)R=0.87 with SNP26
SNP26Reduced linoleic acid7-16% (depending on year)R=0.87 with SNP23
SNP9, SNP13, SNP14, SNP15, SNP20Fatty acid content variationVariableR=0.81-1.00 among these SNPs

These polymorphisms demonstrate high genetic diversity (nucleotide diversity π=0.0038) within studied populations, with linkage disequilibrium (LD) decay occurring rapidly (R² dropping to <0.1 at distances of approximately 200bp) . Intragenic recombination tests have confirmed this pattern, indicating 174 different recombination events in the calculated haplotypes with a minimum of 19 recombination events .

What techniques are most effective for isolating and characterizing FAD2-2 genes?

For successful isolation and characterization of FAD2-2 genes, researchers should consider the following methodological approaches:

  • Gene isolation techniques:

    • RT-PCR using gene-specific primers designed from conserved regions of FAD2 sequences

    • Rapid Amplification of cDNA Ends (RACE) for obtaining complete coding sequences

    • Genome walking for isolating promoter and regulatory regions

  • Expression analysis methods:

    • Quantitative real-time PCR (qRT-PCR) for tissue-specific and developmental expression profiling

    • RNA-Seq for comprehensive transcriptome analysis

    • Northern blotting for validation of expression patterns

  • Functional characterization approaches:

    • Heterologous expression in yeast systems (such as demonstrated with safflower FAD2 in Rhodotorula glutinis)

    • Complementation studies in Arabidopsis fad2 mutants to confirm function

    • Transient expression in model plants like Nicotiana benthamiana

One successful approach demonstrated in soybean involved isolating the 1929 bp 5'-upstream genomic DNA fragment of FAD2-1B, followed by sequence analysis to identify seed-specific promoter motifs including E-box, SEF4, Skn-1 motif, AACACA, and AATAAA .

How can recombinant FAD2-2 activity be measured in experimental systems?

Measurement of recombinant FAD2-2 enzymatic activity requires specialized approaches due to its membrane-bound nature. Recommended methods include:

  • Heterologous expression systems:

    • Yeast expression platforms (Saccharomyces cerevisiae or Rhodotorula glutinis)

    • Plant cell-free translation systems

    • Baculovirus-insect cell expression systems for higher eukaryotic post-translational modifications

  • Activity assay techniques:

    • Gas chromatography (GC) analysis of fatty acid methyl esters (FAMEs)

    • Liquid chromatography-mass spectrometry (LC-MS) for precise quantification

    • Radioisotope-labeled substrate tracking with thin-layer chromatography

  • Data analysis methods:

    • Calculation of conversion rates (oleic to linoleic acid)

    • Determination of enzyme kinetics parameters (Km, Vmax)

    • Comparative analysis with wild-type and mutant forms

Studies have shown that FAD2-2 from Elaeis guineensis specifically uses oleic acid as a substrate and converts it to linoleic acid, demonstrating substrate specificity that can be leveraged in experimental designs .

How does FAD2-2 contribute to abiotic stress tolerance in plants?

FAD2-2 plays a crucial role in plant adaptation to environmental stresses through modification of membrane lipid composition:

The adaptive responses are evidenced by studies showing differential expression between olive cultivars (Picual and Arbequina) under varying temperature, darkness, and wounding conditions .

What phenotypic changes occur with altered FAD2-2 expression in plants?

Modification of FAD2-2 expression produces distinct phenotypic changes affecting both development and stress responses:

Expression ModificationObserved Phenotypic EffectsBiochemical Changes
OverexpressionModified seed germination and hypocotyl elongationIncreased polyunsaturated fatty acid content
Knockout/mutationDwarf phenotypes at 22°C (observed in Arabidopsis)Altered membrane lipid composition
Tissue-specific expressionChanges in seed oil qualityShifted oleic:linoleic acid ratios

These phenotypic alterations suggest that FAD2-2's role extends beyond basic fatty acid metabolism to fundamental developmental processes. The mechanisms involve changes in membrane properties and activation of hormone-dependent developmental pathways .

Notably, these effects are specific to fatty acid desaturases, as similar phenotypic changes were not observed when plants were transformed with genes other than fatty acid desaturases .

How have FAD2 genes diversified during plant evolution?

FAD2 genes show fascinating evolutionary patterns across plant species:

  • Gene duplication events:

    • Seed-specific FAD2 genes evolved independently after segregation by duplication from constitutively expressed FAD2 genes

    • Non-allelic nature of FAD2 gene families (as shown in safflower) indicates evolution through gene duplication

  • Sequence conservation and diversification:

    • Approximately 20 distinct motifs identified in fatty acid desaturases

    • FAD2 subfamily consistently contains motifs 2, 5, 6, 15, 16, and 17

    • Conserved transmembrane domains and histidine clusters maintained across diverse species

  • Regulatory element evolution:

    • The 5'UTR intron analysis suggests that intron multiplication may have occurred through tandem duplication

    • Alternative mechanisms include creation of new introns by internal gene duplication

    • Selective pressure analysis (Tajima neutrality test, D = 0.84) indicates no significant selection pressure on the 5'UTR intron in olive FAD2-2

The evolutionary history of FAD2 genes reflects their fundamental importance in plant adaptation to varying environments and the fine-tuning of lipid metabolism across different plant lineages.

How do FAD2-2 genes compare between soybean and other oilseed crops?

Comparative analysis of FAD2-2 genes across various plant species reveals both conserved and species-specific features:

  • Structural conservation:

    • Core catalytic domains and histidine clusters remain highly conserved

    • Transmembrane topology preserved across diverse plant species

  • Expression pattern differences:

    • In soybean, FAD2-1B shows highly seed-specific expression

    • Olive FAD2-2 demonstrates constitutive expression with tissue-specific regulation

    • Safflower contains multiple FAD2 isoforms with functional divergence

  • Promoter region variation:

    • Soybean FAD2-1B promoter contains seed-specific elements like E-box, SEF4, Skn-1 motif

    • Comparative studies show this promoter has similar activity to the 35S promoter specifically in seeds

    • The seed-specific activity is associated with cis-elements found in the 1-248 bp, 451-932 bp, and 1627-1803 bp regions

These comparative findings provide valuable insights for genetic engineering approaches targeting specific expression patterns or functional modifications in crop improvement programs.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.